KEGG   Loxodonta africana (African savanna elephant): 100669432
Entry
100669432         CDS       T04351                                 

Gene name
PERP
Definition
(RefSeq) p53 apoptosis effector related to PMP-22
  KO
K10136  TP53 apoptosis effector
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100669432 (PERP)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 DUF973 Phlebo_G2_C
Other DBs
NCBI-GeneID: 100669432
NCBI-ProteinID: XP_003404051
UniProt: G3SL03
LinkDB
Position
Unknown
AA seq 193 aa
MLRCGLACERCRWILPLLLLCAIVFDIIALAGRGWLQSSNHEETSSLWWKCNSEGGGTGS
FEQGCQSLMDFAWGRAAAAMLFCGFIILVICFVLSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQEFRLHDNHDITYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt   +upstreamnt  +downstreamnt
atgctgcgctgcggcctggcctgcgagcgctgcaggtggatcctgcccctgctcctgctc
tgcgccatcgtcttcgacatcatcgcgctggccggccgcggctggctgcagtcgagcaac
cacgaagagacgtcgtcgctgtggtggaaatgcaacagcgagggcggcggcacagggtcc
ttcgagcaaggctgccaaagcctcatggacttcgcgtggggaagagctgcagctgccatg
ctcttctgtggcttcatcatccttgtcatttgcttcgtcctctccttctttgccctctgt
ggaccccaaatgcttgtcttcctgagagtgattggcggcctccttgccttggctgctgtg
ttccagatcatctccctggtaatttacccagtgaagtacacccaggaattcaggcttcac
gacaatcacgatatcacctacatctataactgggcctatggctttggctgggcagccaca
atcatcctcattggctgtgccttcttcttctgctgcctccccaactacgaagatgacctt
ctgggcaatgctaagcccagatacttctacacctctgcctaa

DBGET integrated database retrieval system