KEGG   Loxodonta africana (African savanna elephant): 100669506
Entry
100669506         CDS       T04351                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase isoform X1
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04152  AMPK signaling pathway
lav04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100669506 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100669506 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100669506 (EEF2K)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100669506 (EEF2K)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   100669506 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1
Other DBs
NCBI-GeneID: 100669506
NCBI-ProteinID: XP_003418860
UniProt: G3TPE2
LinkDB
Position
Unknown
AA seq 722 aa
MADEDLIFRLEGVDGSQTFRSGPDGNSDADSDDEEGYFICPITDDPRSNQNANSKVNNYY
SNLTKSEQYGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATECAIRHRYNAVTGE
WLQDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVGRDVYFE
DVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKERPGKPLFHLEHYIEGKYIKYNSNS
GFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNLGVR
GMALFFYSHACNRICKSMGLAPFDLSPKERDTVNQNTKLLQSAKTILRGTEEKCGSPRVR
TLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDNPHWPVFGDLDNMAH
RDHDHLDNQRDSENSGDSGYPSEKRGELDDPEPQEHGHSNGNRRYESDEDSLGSSGRVCV
EQWNLLNSSRLHLPRPSAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFCEKD
EEWDRESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDYLLK
AAEAGDRQSMILVARAFDSGQNLSPDRSRDWSEALHWYNTALETTECDEGGEYDGMQDEP
RYMLLAREAEMLFTGGFRLEKDPQRSGNLYTEAAEAAMEAMKGRLANQYYQKAEEAWAQM
EE
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggcgttgatggcagccagacatttcgg
tctggtcctgatggcaattctgatgcagacagcgatgatgaggaaggttacttcatctgc
cccatcactgatgaccccagatctaaccagaatgccaattccaaggttaataactactac
agcaacctaacaaaaagtgagcagtatggatccccagcaagttccttccactttaaggaa
gcctggaagcatgcaatcgagaaggccaaacacatgcccgacccctgggctgagttccac
ctcgaggacattgccacagaatgtgccatacgtcacaggtacaacgctgtcacgggcgag
tggctacaagacgaagttctgatcaagatggcatctcagccctttggccgtggagcgatg
agggagtgctttaggacgaagaagctctccaacttcctgcacacccagcagtggaagggg
gcctccaactacgtggcaaaacgctacatcgagtctgtgggcagggacgtgtactttgag
gatgtgcgtctacagatggaggccaagctctggggggaggagtataaccggcacaagccc
cccaagcaggtggacattatgcaaatgtgcatcatcgagttgaaggagagacctggtaag
ccccttttccacctggaacactacattgagggcaagtacatcaagtacaactccaactcg
ggctttgtccgcgatgacaacatccgcctgacgccacaggccttcagccacttcacgttt
gagcgttctggccatcagctaattgtggtggacatccagggtgtgggcgacctctacact
gacccgcagatccacactgagacaggcactgactttggagacggcaacctcggcgttcgg
ggcatggcccttttcttctactcgcatgcctgcaaccggatctgcaagagcatgggcctg
gcaccattcgacctctcgccaaaggagagggacaccgtgaatcagaacaccaagctgctg
caatcagccaagaccatcttgagggggactgaggaaaaatgtgggagcccccgagtaagg
accctttctgggagccggccccccctgctccttcgcctttcagagaactctggagatgag
aacatgagtgatgtgacctttgactctctgccttcttcaccgtcttcagccacaccgcac
agccagaaactagacaacccccattggccggtgttcggcgaccttgataacatggcacac
agagaccatgaccatctggacaaccagcgggactctgagaacagtggggacagcggatac
cctagtgagaagcggggtgagctggatgaccccgagccccaagaacacggccactcaaat
ggtaatcggaggtacgagtctgacgaagacagcctgggcagctccggacgggtttgtgtg
gagcagtggaatcttctcaactcttcccgcctccacctgccgagaccttcggctgtggcc
ctggaagtgcaaaggcttaatgctctggaccttgaaaagaagattgggaagtccattttg
gggaaggtccatctggccatggtgcggtaccatgagggcgggcgcttctgtgagaaggac
gaggagtgggaccgtgagtcggcggtcttccacctggagcacgcggctgacctgggcgag
ctggaggccattgtgggcctggggctcatgtactcgcagctgcctcaccacatcctggct
gacgtctctctgaaggagacagaggagaataaaacaaaaggattcgattacttactaaag
gcagctgaagctggtgacagacagtcaatgatcctggtggcacgagcttttgactctggc
cagaacctcagcccagacaggtcccgagactggtcagaagccctgcactggtacaacact
gcgctagagaccacggagtgtgatgagggcggtgaatatgacgggatgcaagatgagcct
cggtacatgctgctggccagggaggctgagatgctgttcacaggtggcttcaggctggag
aaggatccccagagatcaggcaacttgtacactgaggcagccgaagcagccatggaagcc
atgaagggccgcctggccaaccagtactaccagaaggcagaggaagcctgggcccagatg
gaggaatga

DBGET integrated database retrieval system