KEGG   Loxodonta africana (African savanna elephant): 100669535
Entry
100669535         CDS       T04351                                 

Gene name
TRPV5
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 5
  KO
K04974  transient receptor potential cation channel subfamily V member 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
lav04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100669535 (TRPV5)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100669535 (TRPV5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lav04040]
    100669535 (TRPV5)
Ion channels [BR:lav04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100669535 (TRPV5)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank_5 Ank_4 Ank Ion_trans
Other DBs
NCBI-GeneID: 100669535
NCBI-ProteinID: XP_003422872
LinkDB
Position
Unknown
AA seq 510 aa
MGVPPPKAKGPWVQLQKLLTSWLIRGGDWDQRMEEAHMQQQKRIRESLLLRAAKENDLCA
LKELLLDGACDIRQRGALGETALHVAALYDNLDAALLLLEAAPELVREPMVSELYEVRLG
QTALHIAVVNQNVNLARALLAHGASVSARATGVAFHRSSRNLIYFGEHPLSFAACVGSEE
LVRLLIEHGADIRAQDALGNTVLHILTLQPNKTFACQMYNLLLSFDGRGGDPLQSLDLVP
NHQGLTPFKLAGVEGNTVMFQHLMQRRKHIQWTYGPLTSTLYDLTEIDSWGEELSFLELV
VSSKKREARQILDQTPVKELVSLKWKRFGRPYFYVLGAIYLLYIICFTMCCIYRPLKSRG
GNHTHSRDITIFQQKPLQEAYITYQDNVRLVGELVTIFGAVIILLLEIPDIFRVGATRYF
GQTILGGPFHVIIITYACMVLVTMVLRLTNVNGEVVPMSVALVLGWCSLMYFARGFQMLG
PFTIMIQKMIFGDLMRFCWLMAVVILGFAS
NT seq 1531 nt   +upstreamnt  +downstreamnt
atgggggtgcccccacccaaggctaaggggccctgggtccagctccagaaacttctgacc
tcctggctcatcagaggaggcgactgggatcagcgtatggaggaggcacacatgcagcaa
cagaagagaattcgggagtctctactgcttcgggccgccaaggaaaatgacctgtgtgcc
ctaaaggagcttctgctggatggagcctgtgacatccgacaaagaggggccctaggggag
acggcgctgcatgtggctgccctctacgacaacctggacgcagccctgctgctgttggag
gcggccccggagctggtccgggagcccatggtgtcggagctttatgaggtgaggctgggc
cagactgcactgcacatcgctgtcgtgaaccagaatgtgaacttggcacgagccctgctt
gctcacggggccagcgtctctgcgagggccacaggggtggccttccaccgaagctcccgc
aacctcatctactttggggagcacccactgtcctttgctgcctgcgtgggcagcgaggag
ctcgtgcggttgctcattgagcacggagcggacatccgagcccaggacgccctgggaaac
actgtgctgcacatcctcaccctccagcccaacaagacctttgcctgccagatgtacaac
ctactgctctccttcgatggccgtgggggggaccccctgcagtccttggacctcgtgccc
aaccaccagggcctcactcccttcaagctggcgggggtggagggcaacaccgtgatgttc
cagcacctgatgcagcggcggaagcacatccagtggacctacgggccactgacttccacc
ctgtacgacctcacggagatcgactcctggggagaggagctgtcttttctggagcttgtg
gtctcctccaagaagcgtgaggcgcgccagatcctagatcagactcctgtgaaggagctg
gtgagcctcaagtggaagcgttttgggaggccatatttctacgtgctgggcgccatctac
ctcctctacatcatctgcttcaccatgtgttgcatctaccgccccctcaagtcccgtgga
ggcaaccacacacattctcgggatatcaccatcttccaacagaaaccactacaggaggcc
tatataacctaccaggataacgtccgactggtgggggagctggtgaccatcttcggggct
gtgatcatcctgctcttagagatcccggacatcttcagggtcggggccactcgctatttt
gggcagaccatcctcggggggccatttcatgtcatcatcatcacctatgcttgcatggtg
ctagtcactatggtcttgcggctcaccaatgtcaacggggaggtggtgcccatgtctgtc
gccctggtgctgggctggtgcagcctcatgtactttgcacgaggattccagatgctgggc
cccttcaccatcatgatccagaagatgatctttggagacctgatgcggttctgctggctc
atggctgtggtcatcctgggctttgcctcag

DBGET integrated database retrieval system