KEGG   Loxodonta africana (African savanna elephant): 100669583
Entry
100669583         CDS       T04351                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04062  Chemokine signaling pathway
lav04066  HIF-1 signaling pathway
lav04068  FoxO signaling pathway
lav04217  Necroptosis
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04630  JAK-STAT signaling pathway
lav04659  Th17 cell differentiation
lav04917  Prolactin signaling pathway
lav04920  Adipocytokine signaling pathway
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04935  Growth hormone synthesis, secretion and action
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05169  Epstein-Barr virus infection
lav05200  Pathways in cancer
lav05203  Viral carcinogenesis
lav05205  Proteoglycans in cancer
lav05206  MicroRNAs in cancer
lav05212  Pancreatic cancer
lav05221  Acute myeloid leukemia
lav05223  Non-small cell lung cancer
lav05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lav05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100669583 (STAT3)
   04066 HIF-1 signaling pathway
    100669583 (STAT3)
   04068 FoxO signaling pathway
    100669583 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100669583 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100669583 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100669583 (STAT3)
   04062 Chemokine signaling pathway
    100669583 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100669583 (STAT3)
   04917 Prolactin signaling pathway
    100669583 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100669583 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669583 (STAT3)
   05206 MicroRNAs in cancer
    100669583 (STAT3)
   05205 Proteoglycans in cancer
    100669583 (STAT3)
   05203 Viral carcinogenesis
    100669583 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100669583 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100669583 (STAT3)
   05221 Acute myeloid leukemia
    100669583 (STAT3)
   05223 Non-small cell lung cancer
    100669583 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100669583 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100669583 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100669583 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100669583 (STAT3)
   05161 Hepatitis B
    100669583 (STAT3)
   05160 Hepatitis C
    100669583 (STAT3)
   05163 Human cytomegalovirus infection
    100669583 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100669583 (STAT3)
   05169 Epstein-Barr virus infection
    100669583 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100669583 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100669583 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100669583 (STAT3)
Transcription factors [BR:lav03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100669583 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 E2R135 DUF4795 Syntaxin-6_N AP1AR Fib_alpha
Other DBs
NCBI-GeneID: 100669583
NCBI-ProteinID: XP_003414286
LinkDB
Position
Unknown
AA seq 769 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNT
IDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMDLTSECATSPM
NT seq 2310 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcagctcgacacgcggtacctggagcagttgcatcag
ctgtacagtgacagcttcccgatggagctaaggcagtttctggccccttggattgagagt
caagattgggcatatgctgccagcaaagaatcacatgccactttggtatttcataatctc
ttgggtgagattgaccagcagtatagccgctttctacaagagtcaaatgttctctatcag
cacaaccttcgaagaatcaagcagttccttcagagcagatatcttgagaagccaatggag
attgctcgaattgtggcccggtgcctgtgggaagagtcccgcctcctccaaactgcagcc
actgcagcccagcaagggggccaggccaaccaccctacagctgctgtggtgacagagaag
cagcagatgctggagcagcacctacaggatgttcggaagagggttcaggatctagaacag
aaaatgaaagtggtagagaacctccaggatgactttgatttcaactataaaaccctcaag
agtcaaggagacatgcaagatctgaatggaaacaaccagtcagtgaccaggcagaagatg
cagcagcttgaacagatgcttacagcgctggaccagatgcgaagaagcattgtgagtgag
ttggctgggcttttgtcagcaatggagtacgtgcagaaaactctcacggatgaagagctg
gctgactggaagaggaggcaacagattgcttgcattggaggccctcccaacatctgccta
gatcgcctagaaaactggataacctcattagcagaatctcaacttcagacccgccagcaa
attaagaaactggaggagttacagcaaaaagtttcctataaaggggaccccattgtacag
caccggccaatgctggaggagagaattgtagagctgtttagaaacttaatgaaaagtgcc
ttcgtggttgagcggcagccctgcatgcccatgcaccctgaccggcccttggtcatcaag
actggtgtccagtttactactaaagtcaggttgttggtcaagttccctgagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactctggggatgttgcagctctcagagga
tcccggaaatttaacattctgggcacaaacacaaaagtgatgaacatggaagagtccaac
aatggcagcctgtctgcagaattcaagcacttgaccctgagggagcaaagatgtggtaat
gggggccgagcaaattgtgatgcctccctaattgtgaccgaggagctgcacctgatcact
tttgagactgaggtatatcaccaaggcctcaagattgacctggagacccactctttgcct
gttgtggtgatctccaatatttgtcagatgccaaatgcctgggcttccatcctgtggtat
aacatgctgaccaacaaccccaagaacgtgaacttttttaccaagcccccaatcggaacc
tgggatcaagtggccgaggtgctgagctggcagttctcctccaccacaaagcgagggttg
agcattgaacaattgactacgctggcagagaagctcttgggacctggtgtgaactactca
gggtgtcagatcacttgggctaaattttgcaaagaaaacatggctggcaaaggcttctct
ttctgggtctggctggacaatatcattgaccttgtgaaaaaatacatcctggccctttgg
aatgaagggtacataatgggcttcatcagtaaggagcgggagcgggccatcctgagcacc
aagcccccaggcaccttcctgctaagattcagtgaaagcagcaaagaaggaggaatcacc
ttcacttgggtggagaaggacatcagcggtaagacccagatccagtctgtggaaccatat
accaaacagcagctgaacaacatgtcatttgctgaaatcatcatgggctataagatcatg
gatgccaccaacatcctggtgtctccgctggtctatctctaccctgacattcctaaggag
gaggcgtttggaaagtattgtcggccagagagccaggagcatcctgaagctgacccaggt
gctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacctgcagcaatacc
attgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataatggt
gaaggtgctgaaccctcagcaggagggcagtttgagtccctgacctttgacatggacttg
acctcggagtgcgctacctcgcccatgtga

DBGET integrated database retrieval system