KEGG   Loxodonta africana (African savanna elephant): 100669658
Entry
100669658         CDS       T04351                                 

Gene name
BRCA2
Definition
(RefSeq) LOW QUALITY PROTEIN: breast cancer type 2 susceptibility protein
  KO
K08775  breast cancer 2 susceptibility protein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav03440  Homologous recombination
lav03460  Fanconi anemia pathway
lav05200  Pathways in cancer
lav05212  Pancreatic cancer
lav05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100669658 (BRCA2)
   03460 Fanconi anemia pathway
    100669658 (BRCA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100669658 (BRCA2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100669658 (BRCA2)
   05224 Breast cancer
    100669658 (BRCA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100669658 (BRCA2)
   03036 Chromosome and associated proteins [BR:lav03036]
    100669658 (BRCA2)
   03400 DNA repair and recombination proteins [BR:lav03400]
    100669658 (BRCA2)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    100669658 (BRCA2)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100669658 (BRCA2)
DNA repair and recombination proteins [BR:lav03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     100669658 (BRCA2)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100669658 (BRCA2)
SSDB
Motif
Pfam: BRCA-2_helical BRCA2 BRCA-2_OB3 BRCA-2_OB1 Tower
Other DBs
NCBI-GeneID: 100669658
NCBI-ProteinID: XP_023403030
LinkDB
Position
Unknown
AA seq 3409 aa
MPVGFKERPTFFEIFKAQCSKADLGPVSLNWFEELSSEAPPYKSERAEEAEYKISSYGSN
PFKTPQRKPYYNQLASTPIIFKDQGKDIASSKQSRFSVRAEMSQAKDVTSPPLNPCLSES
PVLRCMHVTPQREKSVLCGSLFHTPKLMKGQTPKRISESLGAEVDPDMSWSSSLATPPTL
SSTVLIVRDEEAPETVFPDDSAISKNHFSNHNKSLKKNDQFIPSVPDSENENQGEVISRV
SAELGNFLGEVNSCEDHPEGGAPSALEEEGHETVAHISEEDSFSLCVSKYKTGNLQKVKT
DKTRKKYFNKTKAGECEEAKKLEESRHLFAFEMEPNDSDPLGSSAPGEEPTGNIGHTVSK
ELVASSASEWPQLTLSGLNGTQMERIPLLPTSCDQNNSEKDLIGTEEECANFTTSENSLS
RISRLPKTEKLLNEERVVNKSEEEQSPLSHKDSILAVKQTASGTSPVASLSQGITKSIFK
IRESPDVAFGVVFSDNMTDSNLKEKPEAPESGLEIGANCSQRWGSLCPSLVGNGSCPVTT
KHASVTLKNAGLISTLKKKTKKFIYSVNDKTSYPGEKMQKDQESEPTHCSAQFEAPLTFL
NSGSGLLHSSVKKNSSQNDTEGPTLSLTSSFKTILRKSSNNESSCNNKVISQDLDYKATE
VNTEEPLSPVTTGPDCPSCLQESHGDGDPTGQRASDVKRKVLAAAHRPAVRHSEVELSGV
HFQLQKSFLYDHHNASSLGLTPRSKDPLSNSVVISRDKESYKMSEELKHKNREATFELTK
NIPLEKNQEMFVLNENSKKAELSPPEKYMKVASHFVKVQFNQNIDVTVISKEQEETALIS
KITIDPNSKELFPENEDNCVFQMTNKRNTAILEDIKGLPKASFGCVKEPVLKSPTMVVYS
DIGDERAAQLLLTEGDDSSDVVRDLTEENRNREKQHLKMTLSQHVKSDVSLEVDRKSSRN
NSYVGRRAGLLDPVSNYSFGGGFRTASDKEIKLSEHNIKKSKALFKDIEDQYPESLACVE
IVNPLSLDDQKKLNRPHALDWQTLKTASGDEWNSVFVSDNRSGRTAPQILSLKQDFNSNH
NLTPSQKAEITELSTILEESGSQFEFTQFRKPSRILENNTCERSENQITVLNNSSEGWKD
VARGVTTNAPPTSQVDNSKKWDGAVGDKQKVAGLLKSNSDESASGCLTHKNKEKFTGFCS
ALGTKISVSGEALQSALKLFRDIEDVREDASAEVDRGGSSRSQCASVVSVSELKNFNSDE
NLSEKHSKCHVILQNNIDITTGMFVEWNTDSCKRNTDEEDKCTGTSRNACNLGESNGNES
SRNDTVCIYEDENALPCMTDQHDVYLEVPRQFIKEGNNEIKEGVSDLTCLEVVKAEETFH
VDSSDKQSASNKMGQNVKNFDICDLPIQAANRKNIRVSKESLNKVVSLFDKKYAEEELSN
FSDSLSSELLSDLNNKMDSSSNEERNTVKNKIWEGSNPVGTENKLLTVHRQPKCEIEKTR
EPTMLGFHTASGKKVKIAKQSLDKVKNLFDENEQDNSSEVFSFPHQGAKTVKEIEECKEG
LELACETVETTTFSKSEDMVNSLGDNKRGVFSDETMELVNDHLCSHTENLKTSSSVSSEV
EVHENVEKETAKSPTTCFRNRSTCSASENTALAFYTGRGRQISVSQTSLSEAKKWVREGE
LEDQPGKINAAKVACLKEHPQGCVGNPSYGNSSDSIITENDKNHLSEKQDLSYLSNNCLH
NSDLCHSDEVHNESGYLSKNKMDNGGIERVVKNVKDRKSTSVSEVTSTVRKANTNPQTGN
EDICAQKLVTGTSPCKNENVATEFVISDLNNFEVGPPVFSTASGKIVSVSRETIKRVSEI
FADSSSKVVQQNTESKSDADKTKPVADCSAELDGPEGDAFPNPLGGEECSMHSREALDDI
HSAQILPHNQSMSELDKVCEIRPCQVNLKTSDVCKLNTGMLPKSLSSTNACGIFSTASGK
SVQVSDASLQKTRQVFSEIEESTKYLFSKLSFKSNEDSNKFTKEKNTVIHTKNKLLPPQE
GFSSSVNLSASSGFSTASGKQVLISESALHKAKEMLEEFDRITTECSHHLPTSRQDVSKT
PPPIGKRIPKHPVNAKMEKTYYKEFRFSNNSNVENGSSETDHPIKASPHLCQSKQEVSLV
ENVHLLAKEQTLPRNIKMEISKIKTFSNLPVKTNMEVCSTYSKDPENRFETEAVEIARAF
MEDGELTDSEPPSHAKHPQLTCPKSEEPAVRIGKRRNALVSAGEPPIKRSLLNEFDRIVE
NQEKSLQASKSTPDGTIKDRRLFMHRISLTPISCAPIXFSRGKEKQKYRNLSVTAPGQEY
LSKSHLFEHLALVKPSKQFIGFRQPRYIVSATRPEKXEHSVTTGTPTKVFVPPFKTKSRA
QRNEQCAAGNVNLEENKQTQKSAVKLGSGDSENNINEGGIHPFSKSNSHQAAAATLRERG
KEPLDLITNLQNARDRQDTRIKMKQRQRVCPQPGSLYLAKTSTVPRLSLKMAVGGRAPST
CSPKQLYMYGVPEHCIKINSKTAESFRFHAQDYFGKEALWAGKGIQLADGGWLIPSNDGK
AGKEEFYRALCDTPGVDPKLISRDWVYNHYRWILWKLAAMEFSFPKEFANRCLTPERVLL
QLKYRYDVEVDRSRRSAIKKITERDDTAAKTLVLCVSAIISSNTNVHETSSSTTSSVGSR
SVAILELTDGWYAIRAQLDAPLSVLLKKGRLAVGQKIITHGAELVGSPDACTPLEAPESL
LLKISANSTRPACWYAKLGFFPDPRPFSLPLSSLFSDGGHVGCVDVIIQRAYPIQWVEKT
PSGLYIFRDERAEEKEAAKYAETQQKKLEALLAKIQAEFEEQEETAAKQCIPSRALTRQQ
IRALQDGAELYEAVKNAPDPGHLEGYFSEEQLRALSNHRRVLNDKKQAQIQSEFRRAVGS
AEPGGPGLSRDVAAVWKLRVVTYEKKGKDSVILSVWCPSSDLCSLLTEGRRYRIYHLATS
KSKSKSERANIQLTATKKTQYQQLPASDEILLQVYQPREPLHFSKLLDPDFHPPCSEVDL
IGFVVSVVKKPGFAPLVYLSDECHNLLAVKFWTDINEDIVKPPTLIAASNLQWRPESASG
IPTLFAGDVSTFSASPKEGHFQEAFSRAKNAIENTDVFCNDAEDKLQHILTAHDPKWCTP
NKDCTSEPHSAPAGLGADSKFLLSFPNHEINYQSSLSLHSQKXKSLSIPVSAQKTSKSCC
KGEKDSDDQKTVRKRRALDFLSRLPLPPPVSPICTFVSPAAQKAFQPPRSCGTKHETPIK
KAGWTSPQMAPLRRASETSVLESDSIPDEELALINTQALLSGSAGESPLISXSDSTGTTP
TSSEDHLELQRPHATSGIKERANPRASTEDKMSVTQNTTRGLLRRQTQT
NT seq 10230 nt   +upstreamnt  +downstreamnt
atgcctgttggattcaaggagaggccaaccttttttgagatttttaaggcccaatgcagc
aaagcagatttaggaccagttagccttaattggtttgaagaactttcttcagaagctcca
ccatataaatctgaacgtgcagaagaggctgaatataaaatcagcagttatgggtcaaat
ccctttaagacaccacaaaggaaaccctattacaatcagttggcatcaactccgatcata
ttcaaagatcaaggaaaggatattgccagtagtaaacaaagtcgtttctcagtgagggct
gaaatgtctcaagcaaaggatgttaccagcccgcctctcaatccttgtcttagtgaaagt
cctgttctgcgatgcatgcatgtaacaccacaaagagaaaagtcggtattatgtggaagt
ttatttcatacaccaaagcttatgaagggtcagacaccaaaacgtatttctgagagtcta
ggagctgaggtggacccagatatgtcttggtcaagttctttagccacaccaccgactctt
agttctactgtgctaatagtcagagatgaggaagcacctgaaactgtatttcctgatgat
tctgctatttcgaaaaaccatttttccaaccataataaaagtctgaagaaaaatgaccag
tttatcccttctgtgccagacagtgaaaatgaaaaccaaggagaagtgataagtcgtgtt
tcagcagaattggggaacttccttggtgaagtgaatagctgtgaagaccatcctgaaggg
ggagcgccaagtgctctagaagaagaaggacatgaaacagttgcacatatttctgaagaa
gatagtttttcactgtgtgttagtaaatataaaacaggaaatctacaaaaagtaaagact
gacaagactaggaaaaaatatttcaataaaacaaaagctggtgaatgtgaggaagctaaa
aaactggaagaaagtagacatttgtttgcgtttgaaatggaaccaaatgacagtgaccca
ttaggttccagtgcaccaggtgaagagcccactgggaatatcggccacacggtgtccaag
gagcttgtagcatcttcagcctctgagtggcctcagctaaccctctctggcctaaatgga
actcagatggagagaatacccctactacctacttcttgtgaccaaaataattcggaaaaa
gacctaataggcacagaggaagaatgtgccaacttcactacttcagaaaattctttgtca
cgcatttcacgtttaccaaaaacagagaagctactgaatgaggaaagagtggtaaataag
agcgaggaagagcagagtcctttatctcataaagactccattcttgcagtaaagcaaaca
gcatccggaacttctccggtagcttctctgtctcagggtatcacaaagtctattttcaag
ataagagaatcacctgatgtggcttttggtgtggttttctcagataatatgactgattca
aacttaaaagaaaaacctgaagcccctgaaagtggtttggaaataggtgctaattgctcc
cagagatggggttccttatgtccaagtttagttggtaatggaagctgcccagtcaccacc
aaacatgcttctgtaactttgaagaatgctggtttaatatccactttgaaaaagaaaaca
aaaaagtttatttattctgtaaatgataaaacatcttatccaggggaaaaaatgcagaaa
gatcaagaatctgaaccaactcactgttcagcccaatttgaagcaccgcttacgttccta
aatagtggttcaggtttattgcattcttccgtcaaaaaaaatagttcacagaatgatact
gaaggaccaactttgtctttaaccagctctttcaagacaattctgagaaaaagttccaat
aatgaaagcagttgtaataataaagtaatatctcaggatctggattataaagcaacggaa
gttaatacagaagaaccgctgtcccctgtaaccacaggacctgactgtccgtcgtgccta
caggaaagccatggtgatggtgatcccacaggccagagagcttcagatgtaaaaagaaag
gtcttggctgcagcacatcgcccggcagtacgacattcagaagttgaacttagtggtgtt
cactttcaactgcagaaaagctttttatatgaccatcataatgccagcagtcttggttta
actcctcggtccaaggatcctctatcaaactcagttgtgatttctagagataaagaatca
tataaaatgtcagaggaactgaaacataagaatcgtgaagccacttttgaattaaccaaa
aatattcccctggaaaaaaatcaagaaatgtttgtcttgaatgaaaattctaaaaaagct
gagttgtcaccccctgaaaaatacatgaaagtagcctcacattttgtgaaggtacaattt
aaccaaaatatagatgtcacagtaatctcaaaagagcaagaagaaactgctttaatttca
aaaataactatagatccaaactccaaagaacttttcccagagaatgaggataattgtgtc
tttcaaatgacaaataaaaggaatacggctattttagaagatataaagggacttcccaag
gcaagcttcggctgtgtgaaagagcccgttctcaagagccccaccatggtagtgtattca
gacataggtgatgaacgggcagcccaactactgcttacagaaggtgatgactcatcagat
gtagtccgtgatcttacagaggagaacagaaatcgtgaaaagcagcatctaaaaatgact
ctaagtcaacatgtaaagtcagacgtctccttggaggtagacaggaaatcaagcagaaat
aacagttacgtgggaagacgagcaggactcttagatccagtttcaaattacagctttgga
ggtggcttcagaacagcttctgataaagagataaaactctctgaacacaacattaagaaa
agcaaagcgctcttcaaagatattgaagaccagtatcctgaaagtttagcttgtgttgaa
attgtaaatcccttatcattagatgatcaaaagaaactgaacagacctcatgcactagat
tggcagacgctgaaaaccgcatctggggacgagtggaacagtgtgtttgtctctgacaat
agaagtggtcgcacagcgcctcagattttatctttaaaacaagattttaattcaaaccat
aatttaacacctagccaaaaggcagaaatcacagaactttctactattttggaagaatca
ggaagtcagtttgaatttacacagttcagaaaaccaagccgcatattagagaataataca
tgtgagaggtctgaaaaccagataactgtcttgaataactcttctgagggttggaaagat
gttgctcgtggcgtcacaactaatgccccacctaccagccaggtggataacagcaagaaa
tgggacggtgcggttggagataagcagaaggttgctggcctgctgaaaagtaacagtgat
gaaagtgcttctggctgtttaacacataaaaataaagagaaatttacaggcttttgttct
gcacttggcacaaagatcagtgtttctggtgaagctctgcagagtgctctgaagctgttc
agggatattgaggacgttcgtgaagacgcttctgcggaagtagatcgcggaggatcctct
cggagtcagtgtgcttctgtcgtctccgtgtctgagttaaaaaacttcaacagtgatgaa
aatttgagtgagaaacatagtaaatgccacgttatattacaaaataatattgacataact
actggcatgttcgttgagtggaatactgacagttgtaagagaaacacagatgaagaagac
aaatgtactggtaccagtagaaatgcttgcaacttaggagaatccaatggcaatgagtca
agtagaaatgataccgtttgtatttatgaagatgaaaatgccttgccatgtatgactgat
cagcacgacgtgtatctagaagtacctaggcagtttataaaggagggaaacaatgaaatt
aaagaaggtgtatcagatttaacttgtttggaggttgtgaaagctgaagaaacatttcat
gttgatagttcagataaacagtcagcttctaataaaatggggcaaaatgtgaaaaatttt
gacatatgtgatttacccattcaggctgcaaataggaaaaatatcagagtctccaaagag
tcactaaataaagttgtaagtttatttgataaaaagtatgcagaagaagaattgagtaac
ttttcagattctctgagctctgaattgctttctgacctaaataacaaaatggacagttca
agtaatgaggaaagaaatacggttaaaaataaaatatgggaaggaagtaacccagttggt
actgaaaataaattactgactgtccaccgacaacccaaatgtgaaattgaaaagaccaga
gaacccaccatgttgggttttcatacagctagtgggaaaaaagtaaaaattgcaaagcaa
tctttggacaaagtgaaaaatctcttcgatgaaaacgagcaagataacagtagtgaagtc
ttcagttttccacatcaaggggcaaagactgtaaaggagatagaggagtgtaaagaaggg
cttgaattagcatgtgagacagtcgagacaactactttctcgaagtctgaagacatggtg
aattctctaggcgataataagagaggcgttttttccgatgagaccatggagctcgtgaat
gatcatttatgtagccacactgaaaatctcaaaacgtcaagtagtgtttcttcggaagtt
gaagtacatgaaaatgtagaaaaggaaacagcgaaaagtcctacgacttgtttccgaaac
cgctcaacctgttcagccagtgaaaatacagctttagcgttttacacaggacgtggcagg
cagatttctgtgagtcagacgtcactatctgaagcaaagaaatgggttagagaaggagaa
ttggaggatcagccaggaaaaataaatgctgccaaggttgcttgtttaaaagaacaccct
cagggttgtgtaggaaacccctcatatggaaatagttcagatagcatcataacagaaaat
gacaaaaaccatctctctgaaaaacaagatctaagttacttaagtaacaactgtttacac
aattctgatttgtgtcattcagatgaggtacataatgaatcagggtatctctcaaaaaat
aaaatggacaatggtggtattgagcgagtggtgaagaatgttaaagacagaaaaagtact
agtgtttctgaagtaacgtctacggtaagaaaagcaaacacaaacccacaaactggaaat
gaagatatttgtgctcagaaacttgtgactggcacttcaccatgcaaaaatgaaaacgta
gccactgaattcgttatatctgatttaaataattttgaggttggaccacctgtattcagt
acagcaagtggtaaaatagtatctgtttcacgtgaaacaataaaaagagtgagtgagata
tttgcagacagctccagtaaggtcgttcagcaaaacactgagagtaaatcagacgctgat
aaaacgaaacctgtggcagattgctctgcagaattagatggtccagaaggtgatgctttt
cctaaccctctaggtggcgaggagtgcagcatgcattcacgtgaggctcttgatgacatt
catagtgcacaaattttaccacataaccagagtatgtctgaattggacaaagtttgtgaa
atacggccttgtcaggttaacttgaaaacttctgacgtatgtaaattgaacacggggatg
cttcccaagtctctctcttctacaaatgcttgtgggatttttagcacagcaagtgggaaa
tctgtacaggtgtcagatgcttcattacaaaagacaagacaggtgttttctgagattgaa
gagagtaccaagtatctcttttccaaactatcctttaaaagtaatgaagattcaaacaag
ttcaccaaagaaaaaaatactgtgatacataccaaaaacaaattgctaccaccccaggaa
ggcttttcgtctagtgtgaacttgtctgcctcctctggatttagtacagcaagtggaaaa
caggttttaatttctgaaagtgccttacacaaagctaaagaaatgttagaggaatttgat
agaatcacgactgaatgtagtcatcatttacctacgtctagacaagacgtatcaaaaaca
cctcctcccattggtaagagaatcccaaaacaccctgtaaatgccaaaatggaaaaaacc
tactataaagaatttcggttctcaaataactctaacgttgaaaatggttcttcagaaacc
gaccaccctatcaaagcttctccgcatctctgtcagtctaagcaagaggtatcactagtt
gagaatgttcatcttttggcaaaagagcaaactttgcctagaaatataaaaatggaaatt
agtaaaatcaaaactttttctaatcttcctgtgaaaacaaacatggaagtttgttctact
tactccaaagatccagaaaaccgttttgaaacagaagcagtagagattgccagagctttt
atggaagacggcgagctgacagattctgaaccgccgagtcatgccaaacatcctcaactt
acctgcccaaaaagtgaggaaccggctgtaagaattgggaaaagaagaaatgcgcttgtc
tcagcaggagaacccccaatcaaaagaagcttgttaaatgaatttgacaggatagtagaa
aatcaagaaaaatccttacaagcttcaaaaagcactccagatggcacaataaaagataga
agattatttatgcatcgtatttccttaacaccaattagctgtgcaccaatttgattttct
agaggaaaagaaaagcagaaatacagaaatctgagtgttaccgcgcctggtcaggaatat
ctatccaagtcccatttgtttgaacacttggctttggtaaaaccttcgaagcagtttatc
ggtttcagacagccacgttacatcgtttccgccacgagacctgaaaagnncgaacactca
gttactacaggcactccgaccaaagtcttcgttccaccttttaaaactaaatcacgtgct
caaagaaatgaacagtgtgctgccgggaatgttaatttggaagaaaacaaacaaacacaa
aaaagtgccgttaagcttggctctggtgatagtgaaaataacattaatgaaggtggaatt
catccatttagcaaaagtaactcccatcaggcagcagctgcgacgttgagagagcgcggg
aaggaaccactagatttaattacaaatcttcagaatgcgagagatagacaggatacacga
attaaaatgaaacaacggcagcgtgtttgtccacaaccaggcagtctgtatctcgcaaaa
acgtccacggtgccgagactgtctctgaaaatggcagtcggaggccgggccccctccacg
tgctctcctaagcagctatatatgtacggtgttcctgaacattgcataaaaattaacagc
aagactgcagagtctttccggtttcacgctcaggattattttggaaaggaggccttgtgg
gctggaaagggaatacagttggctgatggtggatggctcataccctccaatgatggaaag
gctggaaaagaagaattttatagggctctgtgtgacacccccggtgtggatccaaagctc
atttctagagattgggtctacaatcactatagatggatcctatggaaactggctgctatg
gagttttctttccctaaggaatttgctaatagatgtctgaccccagaaagggtgcttctc
cagctgaaatacagatatgatgtggaggttgatagaagcagaaggtcagctataaaaaag
ataacggaaagggacgacactgctgcaaaaacacttgttctctgtgtttcggcaataatt
tcatcgaacacaaatgtacatgaaacttccagcagtacaacgagtagtgtgggttccaga
agcgtggccatcctcgagcttacagacgggtggtatgctatcagagcccagctcgacgcc
cccctctcggtgctcttgaagaagggcaggctggcggtgggtcagaagatcatcacgcat
ggagcagagctggtgggttctccggatgcttgcacacctctcgaagccccagaatctctc
ctgttgaagatttctgctaacagcacccggcctgcttgttggtatgccaaacttgggttc
ttccctgatcccaggcctttttctctacccttgtcatcactgttcagtgacgggggacat
gttggctgtgttgatgtcatcattcagagagcttaccctatacagtgggtggagaagacg
ccttctggattgtacatatttcgtgatgaaagagcagaagaaaaagaagcagcaaaatat
gcagagacccaacaaaagaaactggaagccctgctcgctaaaatccaagcggaatttgaa
gagcaggaagagactgcagctaaacaatgtataccgtcgcgtgcactaacaagacagcag
atccgtgctctgcaagacggtgcagaactgtacgaagccgtgaagaacgcgccggacccg
ggtcaccttgagggttatttcagtgaagagcagctcagagccttgagcaaccacagacgg
gtgttgaacgataagaagcaagcgcagatacagtcggaattcaggagggccgtggggtct
gcggaaccgggggggccaggcttgtcacgggatgtggcggctgtgtggaagttgcgtgtt
gtgacctatgagaaaaaaggaaaagattcagttatattgagtgtttggtgtccatcatca
gatttatgttccctgttaacggaggggaggagatacagaatctatcatcttgcaacatca
aaatctaaaagtaaatctgaaagagctaacatacagttaacagcaacaaagaaaacccag
tatcaacaactgccggcttcagatgaaatcctactgcaggtttaccagccaagagaaccc
cttcacttcagcaaattattggacccagacttccatcccccttgctctgaggtggaccta
ataggatttgtagtgtctgttgtgaaaaaaccaggttttgcccctttggtctatttgtca
gatgaatgccataatttgctggcagtaaagttctggacagatattaatgaagacattgtt
aaacctcctacactaattgccgcaagcaacctccagtggcggccagaatccgcgtcagga
attccgactttatttgctggagatgtttcgacgttttctgccagtccgaaggagggccac
ttccaggaggcgttcagcagggcgaagaatgccattgagaacactgatgtcttttgcaat
gatgcagaagacaagctacagcatatacttactgcccacgatcccaagtggtgcaccccg
aataaagactgcacttcagagccgcactctgctccagcaggccttggtgcagacagtaag
tttctgctgtcttttcctaatcatgagattaattaccagagttctttgtcacttcatagc
caaaagnggaagtctctttccatacctgtatcagcccagaagacttcgaaatcttgttgt
aaaggggagaaagacagtgatgaccaaaaaaccgtcaggaagagaagagccttggatttc
ttgagtaggctgcccttacctccacctgtcagtccgatttgtacatttgtttctccagcc
gcacagaaagcattccaaccgccacggagctgcggcaccaaacacgaaacacctataaag
aaagcaggatggacttctcctcagatggctccacttagaagggccagtgaaacttctgtt
ttggaaagtgattcgatacctgacgaagagctggcattgataaacacccaggcccttttg
tctggctcagcaggagaaagtccactcatctctnncagtgattccactgggaccacacct
actagttcagaagatcacctggaactgcagaggcctcacgctacatctgggatcaaagaa
cgagcaaatccccgagccagcacagaagataagatgagcgtaacacagaatacgactagg
ggacttctcagacgacagacgcaaacatga

DBGET integrated database retrieval system