KEGG   Loxodonta africana (African savanna elephant): 100669901
Entry
100669901         CDS       T04351                                 

Gene name
GCM1
Definition
(RefSeq) chorion-specific transcription factor GCMa
  KO
K21598  chorion-specific transcription factor GCM
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100669901 (GCM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100669901 (GCM1)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Other transcription factors
   Others
    100669901 (GCM1)
SSDB
Motif
Pfam: GCM
Other DBs
NCBI-GeneID: 100669901
NCBI-ProteinID: XP_003404477
UniProt: G3T8S3
LinkDB
Position
Unknown
AA seq 436 aa
MEPDDVDSEDKEILNWDINDMKLPQNVKKTDWFQEWPDSYAKHIYSSEDRSAQRHLSSWA
MRNTNNHNSRILKKSCLGVVVCSRDCSAEEGRKVYLRPAICDKARQKQQRKRCPNCDGPL
KLIPCRGHGGFPVTNFWRHDGPFIFFQSKGEHDHPKPETKVEAEARRAMKKVHTASSSAS
LKLKRGSETKCLPGETQNRESLPLTWSFQEGVQLPGSYSGPLISNSPQQRSLNGCLSFSK
SYGFGGTTDLADPPASLGPTKLYEKCKLSNSRIYNSADLLQPSVSGIYSDYEDLQAWNKN
VALGRNPLNDKCCPSYPFPLASWPYDFSPSLNSSEPCFQQIPVEPPAAKTSCHPLWPNPG
GDLYEEKVHVDFNSYFPSTTYHSPQEDPFLLTYASHPHHQYSLPGKSSKWDFDEEMRCMG
LEHCNNEMLLNLCPLR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggaaccagatgacgttgattctgaggacaaggagatactaaactgggatattaatgat
atgaaactgccacagaatgtaaaaaaaactgactggttccaggagtggccagattcctac
gcaaagcacatctacagctcagaggacaggagcgcacagaggcacctgagcagctgggcc
atgcgcaacaccaacaaccacaactcccgcatcctcaagaagtcctgcctgggcgtggtg
gtgtgcagccgtgactgctctgctgaggagggtcgcaaggtctacctgcgccctgccatc
tgtgacaaagcccggcagaagcagcagaggaaacgctgtcccaactgcgatgggcctttg
aagctaattccttgccgaggtcacgggggcttcccggtcaccaacttctggaggcacgac
ggacccttcatctttttccagtcaaagggagagcacgatcatccaaaaccggaaaccaaa
gtagaagcagaggcaagaagagcgatgaagaaagtgcacacggcgtcttcctccgcctct
ctgaagctgaagcggggctcagagacaaagtgtcttccaggtgaaacacagaatcgggaa
agtttacctttaacttggtctttccaagaaggtgtccaattgcctggtagttacagtgga
cctttaatttctaacagtccccagcagaggtcactgaatggttgcttatccttctccaag
agttatggttttggggggaccactgatctggctgatcccccagccagcttgggccccact
aagctctatgagaaatgcaaattgtccaatagtaggatctacaatagtgcagacctgctt
cagccttctgtctctggaatttattcggattacgaggatctgcaagcatggaataaaaat
gtggctttgggaagaaatcctcttaatgacaaatgttgccccagttatccttttcctctg
gccagctggccttacgacttctccccttccctgaactcctcagaaccctgtttccagcag
attcctgtggaaccacctgcagccaaaactagctgtcacccattatggccaaatccaggg
ggtgatctttatgaagagaaggtacatgtggattttaacagctacttcccttccaccaca
taccattcaccccaggaggacccttttctcctcacctatgcctctcaccctcaccatcaa
tattccctgccaggtaagagcagcaaatgggattttgatgaagaaatgagatgcatgggt
ttagaacactgcaacaatgaaatgcttctgaatctctgtcctttaagatga

KEGG   Loxodonta africana (African savanna elephant): 100677100
Entry
100677100         CDS       T04351                                 

Gene name
GCM2
Definition
(RefSeq) chorion-specific transcription factor GCMb
  KO
K21598  chorion-specific transcription factor GCM
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100677100 (GCM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lav03000]
    100677100 (GCM2)
Transcription factors [BR:lav03000]
 Eukaryotic type
  Other transcription factors
   Others
    100677100 (GCM2)
SSDB
Motif
Pfam: GCM
Other DBs
NCBI-GeneID: 100677100
NCBI-ProteinID: XP_003417905
UniProt: G3T028
LinkDB
Position
Unknown
AA seq 506 aa
MPADSEQKADCVCPYGMKFNWDINDPQMPQEPTRFDHFCEWPDGYVRFIYRGDEKKAQRH
LSGWAMRNTNNHNGHILKKSCLGVVLCAKACTLPDGSRLQLRPAICDKARLKQQKKACPN
CSSSLELIPCRGHSGYPVTNFWRLAGNAIFFQAKGVHDHPRPESKSETEARRSAIKRQMA
SFYQPQKKRVREPEAEENQDSNGHFSNIPPLENPEQLDIMTDTGFPTAGQPCLSFPNSDA
YKASYDLATFQRDIVPPFQKYPNPRIYLPRPPCSYELVGPGHTHSSPHPTLYKDSTSSPN
DTDWVHLNELQYNVNSYSSYGRSFDFTGKQQGWKPALGKAGFGERTDYGQFQAMTPHPYC
NPEHPCRYLTAPSPGAPALQTVITTTTKVSYQAYQPPALRYSDNACEVKSLSSCKYASEN
TPMSISPEALDLPATVTREASPTGLFPVKIPEDSRAIRSTLAFSQESASSRANQAETWDV
YPSELGSEISYSDRAGQFLNYDNESF
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgccagcagactcagagcagaaggcggactgtgtgtgcccctatgggatgaagttcaac
tgggacatcaacgacccacagatgccgcaggagcccacccgctttgaccacttctgtgag
tggccagatggctacgtgcgcttcatctaccgtggtgacgagaagaaagcacagcgccac
ctgagcggatgggccatgcgcaacaccaacaaccacaatggccatatcctcaagaagtcg
tgcttgggcgtggtgctgtgcgcgaaggcctgcaccctgcctgacggctcccgcctgcag
ctgcggccagccatatgcgacaaggccaggctgaagcagcagaagaaagcatgccccaac
tgtagttcctctttggagctgattccctgccgagggcacagcggataccccgtaaccaac
ttctggcggctggctggcaatgccattttttttcaggccaagggagttcatgaccaccca
aggccagagagtaaatcagagacggaagctagaagaagtgccatcaagagacaaatggcc
tctttttaccaaccccagaaaaagagagttagagagcccgaggcagaagagaatcaagat
agcaatggacatttcagcaacatacctcctttggaaaatccagaacagcttgatataatg
actgacactggtttccccactgcaggacagccttgcctatccttcccaaactctgatgct
tacaaagcttcctatgacctagccaccttccaaagagacatagtgccaccctttcagaaa
tatccaaacccaagaatctatttgcctaggccaccttgtagttatgaactggtaggccct
ggtcatacacattctagcccacaccccaccctttataaagattccaccagtagccctaat
gacacagactgggttcacctgaatgaactacaatataatgtcaattcctacagcagctat
gggaggagcttcgatttcaccggcaaacaacaggggtggaaaccagctcttggaaaagct
ggcttcggtgagaggactgactatggacagttccaggccatgacccctcacccttactgt
aacccagagcatccctgcaggtacctcacagctccatcgccaggtgctccagccctacag
accgtgatcaccaccaccaccaaagtttcctaccaggcctaccaaccccctgctctgaga
tacagtgataacgcctgtgaggttaagagcctttcgagctgtaaatatgcttctgaaaac
acccccatgtctatctctccagaagccttggaccttccagctacagtcaccagggaagcc
tctccaacagggttatttcctgtgaaaattccagaagacagccgggccatcagatccaca
ttggctttttctcaagagtcagcttcctccagggcaaaccaagcagaaacttgggatgtg
tatccatcggagctgggctctgaaatcagttattcggatagagctggtcaattcttgaac
tatgacaatgagagcttttga

DBGET integrated database retrieval system