KEGG   Loxodonta africana (African savanna elephant): 100670141Help
Entry
100670141         CDS       T04351                                 

Gene name
AGT
Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensinogen
  KO
K09821  angiotensinogen
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04072  Phospholipase D signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04261  Adrenergic signaling in cardiomyocytes
lav04270  Vascular smooth muscle contraction
lav04614  Renin-angiotensin system
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
lav04927  Cortisol synthesis and secretion
lav04931  Insulin resistance
lav04933  AGE-RAGE signaling pathway in diabetic complications
lav04934  Cushing syndrome
lav05200  Pathways in cancer
lav05410  Hypertrophic cardiomyopathy (HCM)
lav05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100670141 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100670141 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100670141 (AGT)
   04614 Renin-angiotensin system
    100670141 (AGT)
   04925 Aldosterone synthesis and secretion
    100670141 (AGT)
   04927 Cortisol synthesis and secretion
    100670141 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100670141 (AGT)
   04270 Vascular smooth muscle contraction
    100670141 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100670141 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    100670141 (AGT)
   05414 Dilated cardiomyopathy (DCM)
    100670141 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100670141 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100670141 (AGT)
   04934 Cushing syndrome
    100670141 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100670141 (AGT)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I4: serpin family
   100670141 (AGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serpin
Motif
Other DBs
NCBI-GeneID: 100670141
NCBI-ProteinID: XP_010589414
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MAPAKVSLRATVLCLLAWAGLATSDRVYIHPFHLLTYNDSSLKETGGAHEEGPPDPTFAP
VPIQAKTSSVDEKALQVQLASAVEKLEEVDRLRALEVGTLINLKGLHMYTVLSKTWHTAH
VLSPVALFGTLACFYLGAVDPTASKLQTFLGVPVETQSYTSRLDGRKVLSALQTIQGFLV
AKDGEQGDARLLLSTVVGLFTAPGLHLKQSFVQGLAPFAPNTFSRSLDLSTNPHLAAEKI
KTFIQAVTGWQMSIPLAEVSPDSTLLFNTFVHFQGTMKGFSLLAXAQEFWVDNTTTVSVP
MLSGTGTFQHWSDASNSFSVTRVPFSENACLLLIRPQHASDLEKVEAHTLQVDFLTRKKN
LAPRTVHLTMPQLVLEDSYDLQDLLTQAKLPTLLGPEAHLGKISDGNLRVGQVLTSVLFE
LKADEGKQPPESAQQPXGPEALEVTLNSSFLFVVYEQRAATVHILGRVINLQLRTGLQIS
SRFLYFLWNMHHVRINALQLISVVPHLLTETKKA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcccctgccaaagtgagcctgagagccaccgtcctctgcctcttggcctgggctggc
ctggccaccagtgaccgggtgtacatccaccccttccaccttctcacctataatgacagc
agccttaaggagacagggggagcccacgaagaaggacctccagacccgaccttcgccccc
gttcctattcaggccaagacatcctctgtggacgagaaggccctacaagtccagctggca
tcagcagtagagaaactggaggaggttgacaggctgagggccctggaggttggaacactg
atcaacctgaagggcctccatatgtacacggtgctgagcaagacgtggcatacggcccat
gtgctctctccagtggctctctttggtaccctagcctgtttctacctgggggccgtggat
cccacagccagcaaattacagacattcctgggtgtccctgtggagacccagagctacacc
tcccgactggatgggcgcaaggtcctctctgcactgcagaccatccagggctttctcgtg
gccaaggatggagagcagggtgatgcccggctgcttctgtccacggtcgtgggcctgttc
acagctcccggcctgcacctgaagcagtcattcgtgcagggcctggctccctttgcccca
aacaccttttcacgctctcttgacttgtccactaaccctcatctcgctgctgagaagatc
aagactttcatccaggctgtgacagggtggcaaatgagcatacccctggcagaggtcagc
ccggacagcaccctgcttttcaacacctttgtccacttccaagggacgatgaagggattc
tccctgctggcangagcccaggagttctgggtggacaacaccaccacagtgtccgtgccc
atgctctcaggcactggcaccttccagcactggagcgatgccagcaacagcttctcggtg
acccgtgtgcccttcagtgagaatgcctgcctgctgctgatccggcctcagcacgcctca
gacttggagaaggttgaggcccatactctccaggttgacttcctgacccgcaagaagaat
ctagctcctcggaccgtgcacctgaccatgccacagctggtgctggaggactcctatgac
ctgcaggacctgctcacccaggccaagctgcccaccctgctgggccccgaggcgcacttg
ggcaaaataagcgacggcaacctcagagttggacaggtgctgaccagcgtccttttcgaa
ctcaaagccgatgagggcaagcagcccccagagtcagcccagcagccgngcgggcctgag
gccttggaggtgactctcaacagctcgttcctgttcgtcgtctatgagcagcgcgcagcc
actgtccacatcctgggccgtgtgatcaatctgcagctcaggacggggctccagatcagc
tcccgctttctgtattttctctggaacatgcatcacgtacgtatcaatgctttgcagcta
atttctgtggtccctcatctccttacagagaccaaaaaagcctga

DBGET integrated database retrieval system