KEGG   Loxodonta africana (African savanna elephant): 100671026
Entry
100671026         CDS       T04351                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04390  Hippo signaling pathway
lav05161  Hepatitis B
lav05200  Pathways in cancer
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100671026 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100671026 (BIRC5)
   04215 Apoptosis - multiple species
    100671026 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671026 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100671026 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100671026 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100671026 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lav01002]
    100671026 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100671026 (BIRC5)
Peptidases and inhibitors [BR:lav01002]
 Peptidase inhibitors
  Family I32: IAP family
   100671026 (BIRC5)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     100671026 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100671026 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 100671026
NCBI-ProteinID: XP_003417277
LinkDB
Position
Unknown
AA seq 142 aa
MGAQLLPPAWQLYLKDHRISTFKNWPFLEGCSCTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNSK
QKEFEETAKKVRSAIEQLAALE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgcccagctgttgccccccgcctggcagctgtatctcaaggatcaccgcatctct
acgttcaagaactggcccttcttggagggctgctcctgcactccggagcggatggccgag
gctggcttcatccactgtcccactgagaacgagcctgacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcatctggctgtgctttcctttctgtcaagaagcagtttgaagaattaactctcagtgaa
tttttgaaactggacaaagagcgagccaagaacaaaattgcaaaggaaaccaacagtaaa
cagaaagagtttgaagaaactgccaagaaagtgcgttctgccattgagcagctggccgcc
ttggagtga

DBGET integrated database retrieval system