KEGG   Loxodonta africana (African savanna elephant): 100671262
Entry
100671262         CDS       T04351                                 

Gene name
BBC3
Definition
(RefSeq) LOW QUALITY PROTEIN: bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01524  Platinum drug resistance
lav04115  p53 signaling pathway
lav04210  Apoptosis
lav04215  Apoptosis - multiple species
lav04390  Hippo signaling pathway
lav05016  Huntington disease
lav05162  Measles
lav05200  Pathways in cancer
lav05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100671262 (BBC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100671262 (BBC3)
   04215 Apoptosis - multiple species
    100671262 (BBC3)
   04115 p53 signaling pathway
    100671262 (BBC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100671262 (BBC3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100671262 (BBC3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100671262 (BBC3)
  09172 Infectious disease: viral
   05162 Measles
    100671262 (BBC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100671262 (BBC3)
SSDB
Other DBs
NCBI-GeneID: 100671262
NCBI-ProteinID: XP_023399816
LinkDB
Position
Unknown
AA seq 234 aa
PPCPAGPRERHGPRTPGGQLPRARRGSGPREPAPLPTRQPGALGRVLWPLRARPARCPRP
AARRLPLRPRRPARSHRRPGGPPLARGSPQPAAGPAPGRSSALTLAGGAAPGVAGAQRPG
GPGGRPNAGGPGGPGRGXAMGPRDRGPVSAEGGRPLCAVRAAETGGAAPAPSLALEGPVQ
SHHGTTALTKGPWRPRDGAQLGACTRLVDVEDGGGRLLPPPDALASVGDFFCTM
NT seq 705 nt   +upstreamnt  +downstreamnt
cccccgtgtcccgcaggccccagggagcgccatggcccgcgcacgccaggagggcagctc
ccccgagcccgtagagggtctggcccgcgagagcccgcgccccttcccactcggcagcct
ggtgccctcggccgtgtcctgtggcctctgcgagcccggcctgcccgctgcccccgccct
gctgcccgccgcctacctctgcgcccccgccgccccgcccgcagtcaccgccgccctggg
gggcccccgctggccagggggtccccgcagccggccgcggggcccgcgcccggacggtcc
tcagccctcactctcgccggcggagcagcacctggagtcgccggtgcccagcgcccgggg
ggccctggcgggcggcccaacgcaggcggccccgggggtccggggagaggatgagcaatg
ggcccgagagatcggggcccagtttcggcggaaggcggacgacctctatgcgctgtacga
gcggcagagacaggaggagcagcaccggcaccgtccctcgccctggagggtcctgtacaa
tctcatcatgggactactgcccttaccaagggaccatggcgcccccgagatggagcccaa
ttaggtgcctgcacccgcctggtggacgttgaggacggggggggcaggctcctcccacct
cctgatgccctggccagcgtgggggactttttctgcaccatgtag

DBGET integrated database retrieval system