KEGG   Loxodonta africana (African savanna elephant): 100671333
Entry
100671333         CDS       T04351                                 

Gene name
CAMK4
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV isoform X1
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04020  Calcium signaling pathway
lav04024  cAMP signaling pathway
lav04211  Longevity regulating pathway
lav04371  Apelin signaling pathway
lav04380  Osteoclast differentiation
lav04720  Long-term potentiation
lav04722  Neurotrophin signaling pathway
lav04725  Cholinergic synapse
lav04921  Oxytocin signaling pathway
lav04925  Aldosterone synthesis and secretion
lav05031  Amphetamine addiction
lav05034  Alcoholism
lav05214  Glioma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100671333 (CAMK4)
   04020 Calcium signaling pathway
    100671333 (CAMK4)
   04024 cAMP signaling pathway
    100671333 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100671333 (CAMK4)
   04925 Aldosterone synthesis and secretion
    100671333 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    100671333 (CAMK4)
   04720 Long-term potentiation
    100671333 (CAMK4)
   04722 Neurotrophin signaling pathway
    100671333 (CAMK4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100671333 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    100671333 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    100671333 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    100671333 (CAMK4)
   05034 Alcoholism
    100671333 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671333 (CAMK4)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100671333 (CAMK4)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   100671333 (CAMK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like FTA2 Kdo Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 100671333
NCBI-ProteinID: XP_003404787
LinkDB
Position
Unknown
AA seq 472 aa
MLKVTVPSCSASSCSSVTASAAPGSGSLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSHGNIQEGHKASRDPSP
IEDGNQDIKAIPEEEKVSGDGAQVSFEGAQAELMREQALGEVKDVDINAAEATKMVPEAP
DDGIEVAEPEIEEGLIEEKLKTVEEAADPKEGQENPDLGLGAQQYDVNLPEY
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcctcggtcaccgccagc
gcggccccagggtcgggaagcctcgtcccagattactggatcgacggctccaacagggac
gctctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaattgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggttctagaactc
gtcacaggaggagagctgtttgacaggattgtggaaaaggggtattacagcgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagttgcttacctacatgaaaatgggatc
gtccatcgtgatcttaaaccagagaatctcctctatgcaactccagccccagatgcacca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgctcccgaaattctcagaggctgtgcctatggacct
gaggtagacatgtggtctgtaggaataatcacctacatcctactttgtggatttgaacca
ttttatgatgaaagaggagatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatcctaagaaacggctgactacctttcaagctctccagcacccgtgggtc
acaggaaaagcagccaattttgtacacatggataccgcacaaaagaagctccaagaattc
aatgcccgccgcaagcttaaggcagcagtgaaggcggtggtggcctcttcccggctggga
agtgccagcagtcatggcaacatccaggagggccacaaggccagccgagacccatccccc
atcgaagatggcaaccaggacatcaaagctattccagaagaagagaaagtttcaggagat
ggggcccaagtgtcatttgagggggcacaggctgagctgatgagggagcaggccttaggg
gaagttaaggatgtagatataaatgctgccgaggccaccaagatggtgccagaagcaccg
gatgatgggatagaggtggctgagccagaaatagaagaaggcctaatagaggaaaagctg
aagactgtggaggaagcagcagaccctaaagaagggcaagaaaaccctgatctgggactt
ggggctcaacagtatgatgtgaacctgccagagtactaa

DBGET integrated database retrieval system