KEGG   Loxodonta africana (African savanna elephant): 100671961
Entry
100671961         CDS       T04351                                 

Gene name
NPR1
Definition
(RefSeq) atrial natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04022  cGMP-PKG signaling pathway
lav04024  cAMP signaling pathway
lav04270  Vascular smooth muscle contraction
lav04714  Thermogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav04924  Renin secretion
lav04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100671961 (NPR1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100671961 (NPR1)
   04022 cGMP-PKG signaling pathway
    100671961 (NPR1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100671961 (NPR1)
   04921 Oxytocin signaling pathway
    100671961 (NPR1)
   04924 Renin secretion
    100671961 (NPR1)
   04925 Aldosterone synthesis and secretion
    100671961 (NPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100671961 (NPR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100671961 (NPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100671961 (NPR1)
Enzymes [BR:lav01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100671961 (NPR1)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   100671961 (NPR1)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA Peripla_BP_6
Other DBs
NCBI-GeneID: 100671961
NCBI-ProteinID: XP_003415134
LinkDB
Position
Unknown
AA seq 1060 aa
MPGPGLPVGARLPLLLLLLLPPLLLLRGTHAGNLTVAVVLPLANTSYPWSWARVGPAVEL
ALTRVKARPDLLPGWTVRTVLGSSENALGACSDTAAPLAAVDLKWEHNPAVFLGPGCVYA
AAPVGRFTAHWRVPLLTAGAAALGFGNKDEYALTTRSGPSHAKLGDFVAALHRRLGWERQ
ALVLYAYRPGDDQPCFFVVEGLYMRVRDHLNITVDHLEFAENDRDRYAPLLQTVRRKSRV
IYICSSPDAFRTLMLLALEAGLSGEDYVFFHLDLFGQSLQGAHGPAPQRPWERGDGQDVS
AHQAFQAAKIITYKQPDNPEYLEFLKQLKHLAREQFNFTMEDGLVNIIPASFHDGLLLYV
QAVTETLAYGGTVTDGEGIVQRMWNQSFQGVTGYLKIDSNGDRETDFSLWDMDPETGVFR
VVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNKDPACNQDHFSTLEVLALVGSL
SLLSILIVSFFIYRKLQLEKELASELWRVRWEDVQPSSLERHLRSAGSRLTLSGRGSNYG
SLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRNVLFELKHMRDVQNEHLTRFVGA
CTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNL
KSSNCVVDGRFVLKITDYGLESFRDSDPEQGHTLYAKKLWTAPELLRMASPPARGSQAGD
VYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGQLMQ
RCWAEDPQERPPFQQIRLLLRKLNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEE
KRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLL
NDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVARMALALLDAVRSFRI
RHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETK
AVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG
NT seq 3183 nt   +upstreamnt  +downstreamnt
atgcccggccccgggctccccgtgggcgcccgtctgcccctgctcctgctcctgctcctg
ccgccactgctgctgctccggggcacccacgccggcaacctgacggtggctgtggtgctg
ccgctggccaacacctcgtacccgtggtcgtgggcgcgcgtggggccggccgtggagctg
gccctaacccgggtgaaggcgcggcccgacttgctgcccggctggacggtccgcacggtg
ctgggcagcagcgagaacgcgctgggcgcctgctcggacacggccgcacccctggccgcc
gtggacctcaagtgggagcacaaccccgcggtgttcctgggcccgggctgcgtgtacgcg
gccgcccctgtggggcgcttcaccgcgcactggcgggtgccgctgctgaccgccggcgcc
gcggctctgggcttcgggaacaaggacgagtacgcactgactacccgctcggggcccagc
cacgccaagctgggtgactttgtggcggcgctgcaccgacggctgggctgggaacgccag
gcgctcgtgctctacgcctaccggccgggcgacgaccaaccctgcttctttgtcgtggag
gggctgtacatgcgggtccgcgaccacctcaacatcacggtggaccacctggagttcgcc
gagaatgaccgcgaccgctacgccccgctgctgcagaccgtgcggagaaagagcagagtt
atctacatctgcagctccccagatgccttcagaaccctgatgctcctagccctggaagct
ggcctgagtggggaggactatgttttcttccatctggatctttttgggcaaagcctgcaa
ggtgcacacggccctgctccccaaaggccctgggagagaggggatggtcaggatgtcagt
gcccatcaggcctttcaggctgccaagatcattacatacaaacagccggataatcctgag
tacctggaattcctgaagcagctaaaacacttggcccgtgagcagttcaactttaccatg
gaagatggcctggtgaacatcatcccagcatcctttcatgatgggctcctcctctatgtc
caggcagtgacagagactctggcatatggcgggactgtcactgatggggagggcatcgtt
cagagaatgtggaaccaaagcttccaaggtgtgacaggatacctgaaaattgacagcaac
ggagatcgggagaccgacttctccctctgggatatggatcctgagactggcgtcttcagg
gttgtactgaactacaacgggacttcccaagagctggtggccgtatcagggcgcaaactg
aactggcccctggggtatccccctcctgacatccccaaatgcggttttgacaataaggac
cctgcctgcaaccaagaccacttctccaccctggaggtacttgctttggtgggcagcctc
tccctgctcagcattctgattgtctctttcttcatatacaggaagctgcagctggagaag
gagctggcctcagagctatggcgggtgcgctgggaagacgtgcaacccagtagccttgag
cggcacctgaggagcgcaggcagccggctgactctgagtgggagaggctccaattatggc
tccctgctaaccacagagggccagttccaagtcttcgccaagaccgcatattacaagggc
aacctcgtggctgtgaaacgtgtgaaccgtaaacgcatcgagctgacaagaaacgtcctg
tttgaactgaagcatatgcgagatgtgcaaaatgaacacctgaccaggtttgtgggtgcc
tgcactgacccccccaacatctgcatcctcacagagtactgtccccgtgggagtctgcag
gacattctggagaacgagagcatcaccctggactggatgttccggtactctctcaccaat
gacattgtcaagggtatgctgttcctacacaatggggccatttgctcccatgggaacctc
aagtcatccaactgcgtggtagatgggcgctttgtgctcaagatcactgactacgggctg
gagagcttcagggactcggatccagagcaaggacacaccctctatgccaaaaagttgtgg
acagctcctgagctccttcgaatggcttcaccccctgcccggggctcccaggctggtgac
gtgtacagctttgggatcatccttcaggagattgccctgaggagtggggtcttccatgtg
gaaggcttggacctcagccctaaagagatcatcgagcgtgtgactcggggtgagcagccc
cccttccggccctccctggccctgcagagtcacctggaggagctggggcagctgatgcag
cggtgctgggccgaggacccacaggagcggccgcccttccagcagatccgtctgctgctg
cgcaagttgaacagagagaacagcagcaacatcctggacaacctgctgtcccgcatggag
cagtacgccaacaacctggaggagctggtggaggagcgcacgcaggcctacctggaggag
aagcgcaaggccgaggccctgctctaccagattctgcctcactccgtggctgagcagctg
aagcgtggggaaacagtccaggccgaggcctttgacagcgttaccatctacttcagtgac
attgtgggctttacagccctgtcagcagagagcacgcccatgcaggtggtgaccctgctc
aatgacctgtacacttgctttgatgccgtcattgacaactttgatgtgtacaaggtagag
acgatcggcgatgcctacatggtggtgtctgggctcccggtgaggaacgggcggctgcac
gcccgcgaggtggcccgcatggctctggcgctgctggacgcggtccgctcattccgcatc
cgccaccggccccaggagcagctgcgcttgcgcatcggcatccacacaggcccagtgtgt
gctggcgtggtggggctgaagatgccccgttactgtctctttggggacacggtcaacacg
gcctcacgaatggagtctaacggggaagccctgaagatccatttgtcttctgagaccaag
gctgtcctggaagagtttggtggttttgaactggagcttcgaggggatgtagaaatgaag
ggcaaaggcaaggttcgaacatactggctcctgggggagcgggggagtagcacccggggc
tga

DBGET integrated database retrieval system