KEGG   Loxodonta africana (African savanna elephant): 100671978
Entry
100671978         CDS       T04351                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04540  Gap junction
lav04728  Dopaminergic synapse
lav05012  Parkinson disease
lav05030  Cocaine addiction
lav05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100671978 (DRD2)
   04024 cAMP signaling pathway
    100671978 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100671978 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100671978 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100671978 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100671978 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    100671978 (DRD2)
   05034 Alcoholism
    100671978 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100671978 (DRD2)
G protein-coupled receptors [BR:lav04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    100671978 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srt DUF2207 RIFIN
Other DBs
NCBI-GeneID: 100671978
NCBI-ProteinID: XP_023413914
LinkDB
Position
Unknown
AA seq 472 aa
MDPLNLSWYDDDVESQNWSRPFNGSEAKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVGPGPCLAPALCQSLGGKGSLVIRK
YETFAQEGGTSGVSMLWRVGTLGLARLRPLLLPMLPPCRYTAVAMPMLYNTRYSSKRRVT
VMIAIVWVLSFTISCPLLFGLNNTDQNECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIY
IVLRKRRKRVNTKRSSRAFRANLKAPLKGNYTHSEDMQLCTVIMKSNGSFPVNRRRVEAA
RRAQAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDSSHHGLHTTPDSPAKPEKNGHA
KDHPKIAKIFEIQSMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFI
THILNIHCDCNIPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggatcctctgaacctgtcctggtacgatgacgacgtggagagtcagaactggagccgg
cccttcaatgggtccgaagcgaaggcggacaggccccactacaactattatgccatgctg
ctcaccctgctcatcttcatcatcgtcttcggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacttgatcgtcagcctcgctgtggctgac
ctcctcgtagccacgctggtcatgccctgggttgtctacctggaggtaggtccaggcccc
tgccttgctccagccctgtgccagagcctgggagggaagggctctcttgttataaggaaa
tatgaaacctttgcccaagaagggggtacctctggtgtgagcatgttgtggagggtgggg
accctgggcctagccagactcaggccccttctgctccccatgctcccgccctgcaggtac
acagccgtggccatgcccatgctctacaacacgcgctacagctctaagcgccgagtcact
gtcatgatcgccatcgtctgggttctgtctttcaccatctcctgcccgctgctcttcgga
ctcaacaacacagaccagaacgagtgcatcattgccaaccccgcctttgtggtctactcc
tccatcgtctccttctatgtgcccttcatcgtcaccctgctggtctacatcaagatctac
attgtcctccgcaagcgccgcaagcgggtcaacaccaagcgcagcagccgagctttcagg
gccaacctgaaggccccactcaagggcaactacactcactctgaggatatgcaactctgc
accgttatcatgaagtctaatgggagtttcccagtgaacaggaggagagtggaggctgcc
cgccgagcccaggcccaggagctggagatggagatgctctccagtaccagtccacccgag
aggacccggtacagtcccatccctcctagccaccaccagctgaccctccctgactcgtcc
caccacggcctccacaccactcccgacagccctgccaaaccagagaagaatgggcatgcc
aaagaccaccccaagattgccaagatctttgagatccagtccatgcccaatggcaaaacc
cggacctctctcaagaccatgagccgtaggaagctctcacagcagaaggagaagaaagcc
acccagatgctcgccatcgtgcttggcgtgttcatcatctgctggctgcccttcttcatc
acacacatcctgaacatacactgtgattgcaacatcccgcccgtcctgtacagcgccttc
acgtggctgggctatgtcaacagtgccgtgaaccccatcatctacacgaccttcaatatc
gagttccgcaaggccttcatgaagatcctacactgctga

DBGET integrated database retrieval system