KEGG   Loxodonta africana (African savanna elephant): 100672059
Entry
100672059         CDS       T04351                                 

Gene name
FCER1G
Definition
(RefSeq) high affinity immunoglobulin epsilon receptor subunit gamma isoform X1
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04071  Sphingolipid signaling pathway
lav04072  Phospholipase D signaling pathway
lav04611  Platelet activation
lav04625  C-type lectin receptor signaling pathway
lav04650  Natural killer cell mediated cytotoxicity
lav04664  Fc epsilon RI signaling pathway
lav05152  Tuberculosis
lav05310  Asthma
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100672059 (FCER1G)
   04071 Sphingolipid signaling pathway
    100672059 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100672059 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    100672059 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    100672059 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    100672059 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100672059 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100672059 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lav04147]
    100672059 (FCER1G)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100672059 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 100672059
NCBI-ProteinID: XP_003415060
LinkDB
Position
Unknown
AA seq 85 aa
MISAVLLLLFLLFGQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQMRKAIVSHEKT
DGIYTGLSTRTQETYETLKHEKPQQ
NT seq 258 nt   +upstreamnt  +downstreamnt
atgatttcagcagtgctcttgctcttattccttttgtttggacaagcagccgctttggga
gagcctcagctctgctatatcctggatgcaatcctatttttgtatggtattgttctcact
ctgctctactgtcggctcaagatccagatgcgaaaggcaatagtcagccatgagaagaca
gatggcatttacacgggcctgagcacccggacccaggagacttatgagaccttgaagcat
gagaaaccgcaacagtag

DBGET integrated database retrieval system