KEGG   Loxodonta africana (African savanna elephant): 100672245
Entry
100672245         CDS       T04351                                 

Gene name
TYK2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04217  Necroptosis
lav04380  Osteoclast differentiation
lav04621  NOD-like receptor signaling pathway
lav04630  JAK-STAT signaling pathway
lav04658  Th1 and Th2 cell differentiation
lav04659  Th17 cell differentiation
lav05145  Toxoplasmosis
lav05160  Hepatitis C
lav05161  Hepatitis B
lav05162  Measles
lav05164  Influenza A
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05168  Herpes simplex virus 1 infection
lav05169  Epstein-Barr virus infection
lav05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100672245 (TYK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100672245 (TYK2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100672245 (TYK2)
   04658 Th1 and Th2 cell differentiation
    100672245 (TYK2)
   04659 Th17 cell differentiation
    100672245 (TYK2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100672245 (TYK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    100672245 (TYK2)
   05160 Hepatitis C
    100672245 (TYK2)
   05171 Coronavirus disease - COVID-19
    100672245 (TYK2)
   05164 Influenza A
    100672245 (TYK2)
   05162 Measles
    100672245 (TYK2)
   05168 Herpes simplex virus 1 infection
    100672245 (TYK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100672245 (TYK2)
   05169 Epstein-Barr virus infection
    100672245 (TYK2)
   05165 Human papillomavirus infection
    100672245 (TYK2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100672245 (TYK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100672245 (TYK2)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100672245 (TYK2)
Protein kinases [BR:lav01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   100672245 (TYK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Jak1_Phl Pkinase FERM_F2 FERM_F1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 100672245
NCBI-ProteinID: XP_023407665
LinkDB
Position
Unknown
AA seq 1046 aa
MPLCRWGATARGSKPDGNGAQPMVSRGVLRVHLHWAGPGGGEPWVTFSEASLTAEEVCIY
IAHKIGITPLCFNLFALFDAQGQVWLPPNHILEVPRDSSLNLHFRMRFYFRNWHGMNPQE
PAVYRCGPPGAESSSDQAEHGLQFLDPASFEYIFEQGKHEFVNDVASLWELSSEEEIHHF
KNESLGMAFLHLCHLALHRGVSLEEVAKKISFKDCIPRSFRSQIQQHNALTRLRLRSIFH
KFLRAFQPSHLSQQLVMVKYLATLERLAPCFATEHIPVCHLELPAQAEGKLCYIQDHGQA
TLDPGKESALGPPTHEVLVTGTGGIQWRPVQAEGSGGSGSGSRNPQANLSGKKAQAQEVD
LQPASRPKGLPWASFCDFQDISHLVVKEHHVSVYCQDNKCLELTLPSRATALSFVSLVDG
YFRLTVDSSHYLCHEVAPPRLVMSIQDGIHGPLLDPFVLAKLQPEDGHYLIHWSSSHLYR
LILTVAQRDQAQGSRSLRLRKFTIEQQAGTFTLEGWDRSFPSVGALRAALQDCSLRVGDD
CFSLRRCCLPLSRELSNLIIMRGPAASTRPLNLSQLSFHRVCREEITQLSHLGQGTRTNV
YEGLLRVKGRDSEEDKEEGGDPLSPSRGSGQELRVVLKVLDPSHHDITLAFYEIASLMSQ
VSHVHLAFVHGICVHGSESECPLPLLIGQLPLIPSPWPVPRPLMAPCLTYEPAQRPSFRI
ILRDLTRLQPHNLVDVSAVSPDLPASDPTVFHKRYLKKIRELGEGHFGKVSLYCYDPTND
GTGEMVAVKSLKAGCGPQLRSGWKREIDILRRLYHEHIVKYKGCCEDPGEKSVQLVMEYV
PLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGD
FGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTRCDFS
QSPPLKFIELLGLTQGQMTVLRLTELLERGERLPRPEACPCEIYYLMKNCWEAEASFRPT
FQNLIPILKTVHEKYQGQAPSVFSMC
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgccactgtgccggtggggagccaccgcccgtggcagcaagcctgatgggaacggagct
cagcctatggtcagcaggggagtcctgagggtacacctgcactgggctggccccggtggt
ggggagccctgggtcaccttcagcgaagcctcactgacagccgaggaggtctgcatctac
atcgcacacaaaatcggcatcactccactctgcttcaatctgttcgccctctttgatgcc
cagggccaagtctggctacccccaaaccacatcctggaggtccccagagactccagcctg
aatctgcacttccgcatgaggttttatttccggaactggcatggcatgaaccctcaggag
ccagctgtgtaccgctgtgggccccctggggccgagtcttcctcagatcaagcagagcat
gggctgcaattcttagatccagcctcctttgaatatatctttgagcagggcaagcatgag
tttgtcaatgacgtggcctcactgtgggagctgtccagcgaggaggagatccaccacttt
aagaatgagagcctgggcatggcttttctgcacctctgccaccttgctctccaccgcggt
gtctccctggaggaggtggctaaaaagatcagcttcaaagactgcatcccacgttccttc
cggagccagatccagcagcacaacgcgctgacgcgactgcgcctgcgtagcatcttccac
aagttcctgcgagccttccagcccagccatctctcccagcagctcgtcatggtcaagtac
ctggccacgctcgagcggctggcgccctgctttgccactgagcacataccggtatgccac
ctggagctgccggcccaggctgaggggaagctgtgctacatccaggaccacgggcaggcc
actctggaccccggaaaggagtctgccctgggacccccaacccacgaggtgctggtgaca
ggcaccgggggcattcagtggcggccggtacaggcagagggctctggtggcagcggcagt
ggcagcaggaatcctcaagccaacctttctgggaagaaagcccaggctcaggaggtggac
ctccagccagcgagcaggccaaaggggctgccctgggcctctttctgtgacttccaggac
atcagccacctggtagtgaaggagcaccatgtcagcgtctactgtcaggacaacaagtgc
ctggagctgactctgccctcccgggccacggccctgtccttcgtgtcactggtggatggc
tatttccgcctgacggtcgactcaagccactacctgtgccatgaggtggctcccccacgg
ctggtgatgagtatccaggatgggatccacggacctttgctggatccatttgtgctggcc
aagctccagcccgaggacggtcactacctcatccattggagtagcagccacctctaccgc
cttatcctcaccgtggcccagcgtgaccaggcacaaggctcacggagcttgcgcttacgg
aagttcaccatcgagcagcaggctgggacctttacactggagggctgggaccggtccttt
cccagtgtaggggcactacgggccgccctgcaggactgctcactgcgtgttggggatgac
tgcttctccctgcggcgctgctgcctgccactgtcaagagagctctccaacctcatcatc
atgcgggggcctgcggccagcaccaggccactcaacctcagccagctcagcttccaccgg
gtctgccgggaggagatcacccagctgtcccacttgggccagggcacgaggaccaatgtg
tatgagggcctcctgcgtgtgaagggcagggactctgaggaggacaaggaggaaggcggg
gaccccctctcacccagtaggggcagcgggcaggagctccgagtggtgctcaaggtgctg
gaccccagtcaccatgacatcaccctggccttctacgagattgccagcctcatgagccag
gtctcccacgtgcacctggcctttgtgcacggcatctgtgtacatggttctgagagtgag
tgccccctgcccctgcttataggccagctcccacttatacccagtccctggcctgtcccc
cgacccctaatggcaccctgcctgacctacgagccagcccagcggccgtccttccgcatc
atcctgcgcgacctcactcggctgcagccccacaatcttgttgacgtttctgctgtgagc
ccggacttgccagcgtcagaccccacggttttccacaagcgctatttgaaaaagatccgg
gagctgggcgagggtcactttggcaaggtcagcttgtactgctatgacccgactaacgat
ggcactggtgagatggtagccgtaaagtccctgaaggcaggctgcggcccccagcttcgt
tcgggctggaagcgtgagatcgacattctgcgcaggctctatcacgaacacatcgtcaag
tacaagggttgctgcgaggacccaggcgagaagtcggtgcagctggtcatggagtacgtc
cccctgggtagcctccgagactacctgccccggcacagtgtggggctggcccagctactg
ctcttcgcccagcagatctgcgagggcatggcctacctgcacgcgcagcactacatccac
cgagacttggctgcccgcaacgtgctgctggacaacgacaggctggtcaagatcggggac
ttcggcctggccaaggctgtgcctgaaggccatgagtactaccgcgtgcgcgaggacggg
gacagccccgtgttctggtatgccccggagtgcctgaaggagtgtaagttctactatgca
tctgacgtctggtcctttggggtcaccctgtatgagttgctgacccgctgtgacttcagc
cagagcccccccttgaaattcatcgagctcctaggcctcacccagggacagatgacggtg
ctgaggctcactgagttgctggaacgaggggagaggctgccgcgccctgaggcatgtccc
tgtgagatctattacctcatgaagaactgctgggaggcagaggcctcattccgcccgacc
ttccagaacctcatccccatccttaagacagtccatgagaaataccaaggccaggccccc
tcagtgttcagtatgtgctga

DBGET integrated database retrieval system