KEGG   Loxodonta africana (African savanna elephant): 100672461
Entry
100672461         CDS       T04351                                 

Gene name
VAMP2
Definition
(RefSeq) vesicle-associated membrane protein 2 isoform X1
  KO
K13504  vesicle-associated membrane protein 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04130  SNARE interactions in vesicular transport
lav04721  Synaptic vesicle cycle
lav04911  Insulin secretion
lav04962  Vasopressin-regulated water reabsorption
lav04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100672461 (VAMP2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100672461 (VAMP2)
  09154 Digestive system
   04970 Salivary secretion
    100672461 (VAMP2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100672461 (VAMP2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100672461 (VAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100672461 (VAMP2)
Membrane trafficking [BR:lav04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    100672461 (VAMP2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    100672461 (VAMP2)
SSDB
Motif
Pfam: Synaptobrevin MCU Herpes_LMP2 MgtE PRIMA1
Other DBs
NCBI-GeneID: 100672461
NCBI-ProteinID: XP_023412199
LinkDB
Position
Unknown
AA seq 131 aa
MLAWQHRGACSIYGTVGACSSSAFTEAGLGTPPASWASQVVDIMRVNVDKVLERDQKLSE
LDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIGEWGVGGQGPF
SGEVSPVDPGF
NT seq 396 nt   +upstreamnt  +downstreamnt
atgttagcctggcagcatcggggtgcatgttccatatatggcacagtgggtgcatgttcg
agcagtgctttcactgaggcgggccttggtacacctcctgcctcatgggcctctcaggtg
gtggacatcatgagggtgaatgtggacaaagtcctagagcgcgaccagaagctgtcagag
ctggacgaccgtgcggacgcactccaggcgggggcctcccagtttgaaacaagtgcagct
aagctcaaacgcaaatactggtggaaaaacctcaagatgatgatcatcctgggagtgatt
tgcgccatcatcctcatcatcatcatcggtgagtggggagtgggtggccagggccctttc
tctggagaggtttcccctgtggatcctgggttttga

DBGET integrated database retrieval system