KEGG   Loxodonta africana (African savanna elephant): 100672492
Entry
100672492         CDS       T04351                                 

Gene name
SLC38A1
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 1 isoform X1
  KO
K14990  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 1
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100672492 (SLC38A1)
   04727 GABAergic synapse
    100672492 (SLC38A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100672492 (SLC38A1)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   100672492 (SLC38A1)
SSDB
Motif
Pfam: Aa_trans Cation_ATPase_C
Other DBs
NCBI-GeneID: 100672492
NCBI-ProteinID: XP_003405779
LinkDB
Position
Unknown
AA seq 487 aa
MMHFKSGLELTELQNMTVPEDDNVSNDSNEFTEVENGQINSKFISDRESRRSLTNSHLEK
KKCDEYIPGTTSLGMSVFNLSNAIMGSGILGLAFALANTGILLFLVLLTSVTLLSIYSIN
LLLICSKETGCMVYEKLGEQVFGTTGKLVIFGATSLQNTGAMLSYLFIVKNELPSAIRFL
MGEEDKFSAWYVDGRFLVVIVTFGIILPLCLLKNLGYLGYTSGFSLSCMVFFLIVVIYKK
FQISFTAPGLNSTISANSTNADMYTPKYITFNSKTVYALPTIAFAFVCHPSILPIYSELK
DRSQKKMQMVSNISFFAMFIMYFLTAIFGYLTFYEGVHSDLLRNYHSEDDILILTVRLAV
IVAVILTVPVLFFTVRSSLFELAKKTKFNLCRHILVTVILLVIINLLVIFIPSMKDIFGV
VGVTSANMLIFILPSSLYLKITSQDGDKGTQRIWAALFLGLGVLFSLVSIPLVIYDWACS
SSSDEGH
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgatgcatttcaaaagcggactcgaattaactgaattgcaaaacatgacagtgcccgag
gatgataacgttagcaatgattccaatgagttcaccgaagtagaaaatggtcagataaat
agcaagtttatttctgatcgtgaaagtagaagaagtctcacaaacagccatttggaaaaa
aagaaatgtgatgaatatattccaggaacaacctccttaggcatgtctgtttttaaccta
agcaacgccattatgggcagtgggattttgggactcgcctttgccctggcaaacacggga
atcctactttttctggtacttttgacttcagtgacattgctgtctatatattcaataaac
cttctattgatctgttcaaaggaaacaggctgcatggtttatgaaaagctgggggaacaa
gtctttggcactacaggaaagctagtaatctttggagccacctctctacagaatactgga
gcaatgctgagctacctcttcatagtaaaaaatgaactaccctcagccataaggtttctg
atgggagaagaagacaaattttcagcctggtatgtggatggccgctttctggtggtaata
gttacctttggaataattctccctctgtgtctcttgaagaacttagggtatcttggctat
actagtggattttccttgagctgtatggtttttttcctaatagtggttatctataagaaa
tttcaaatttccttcactgctccagggctaaactcaacaataagtgctaattcaacaaat
gctgacatgtatacgccaaaatacattaccttcaattcaaagaccgtgtatgctttacca
accattgcatttgcatttgtctgccacccctccattctgccaatttacagtgagctgaaa
gatcgatcacagaaaaaaatgcagatggtttcaaatatctccttttttgccatgttcatt
atgtacttcttgaccgccatttttgggtacttgacattttatgaaggtgtgcattcagac
ctccttcgcaactaccacagtgaagatgacatcctcatcctgacggtacggctggctgtc
atcgtcgctgtcatcctcacagtgccagtgttatttttcacagttcgctcatctttattt
gaactggctaagaaaacaaagtttaatttatgtcgtcacatcttggttaccgtcatactc
ttagttattatcaacttattggtgatcttcataccatccatgaaggatatttttggagtc
gtaggggtaacatcagctaatatgctcattttcattcttccttcatctctttacttaaaa
attacgagccaggatggagataaaggaactcagagaatttgggctgcccttttcttgggc
ctgggggtgttgttttctctggtcagcattcccttggtcatctatgactgggcctgctca
tcaagtagtgacgaaggccactga

KEGG   Loxodonta africana (African savanna elephant): 100672778
Entry
100672778         CDS       T04351                                 

Gene name
SLC38A2
Definition
(RefSeq) sodium-coupled neutral amino acid transporter 2 isoform X1
  KO
K14207  solute carrier family 38 (sodium-coupled neutral amino acid transporter), member 2
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04724  Glutamatergic synapse
lav04727  GABAergic synapse
lav04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:lav00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100672778 (SLC38A2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100672778 (SLC38A2)
   04727 GABAergic synapse
    100672778 (SLC38A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100672778 (SLC38A2)
Transporters [BR:lav02000]
 Solute carrier family (SLC)
  SLC38: System A and System N sodium-coupled neutral amino acid transporter
   100672778 (SLC38A2)
SSDB
Motif
Pfam: Aa_trans rpo132
Other DBs
NCBI-GeneID: 100672778
NCBI-ProteinID: XP_003405780
UniProt: G3T7R4
LinkDB
Position
Unknown
AA seq 505 aa
MKKAEMGRFNISPDEDSSSYSSNGDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETDFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGHKAFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQAL
MNIEDTTGLWYLNGDYLVLLVSLVLILPLSLLRNLGYLGYTSGLSLLCMMFFLIVVICKK
FQIPCPMEIAYLVNETINSTLTQPAFAPDVTFNMTEDDSCRPRYFIFNSQTVYAVPILTF
SFVCHPAILPIYEELKDRSRKRMMNVSKISFFAMFLMYLLAALFGYLTFYEHVEAELLHT
YSTMLGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCAGKDFSWWRHSFITVSIL
GLTNLLVIFVPTIRDIFGFIGASAAAMLIFILPSAFYIKLVKKESMKSVQKIGALLFLLS
GIVVMIGSMTLIVLDWVHNAPAGGH
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaagaaagccgaaatgggaagattcaacatttccccggatgaggacagcagcagctac
agttccaacggcgatttcaactactcctaccccactaagcaagctgctctgaaaagccat
tatgcagacgtagatcctgaaaaccagaactttttacttgaatcgaatttggggaagaag
aagtatgaaacagactttcatccaggtactacttcctttggaatgtcagtatttaatctg
agcaatgcgattgtgggcagtggaatccttgggctttcttatgccatggctaatactgga
attgctctgtttataattctcttgacatttgtatccatattttccctgtattctgttcat
ctccttttgaagactgccaatgaaggagggtctttattatatgaacaattgggacataag
gcatttggattagttggaaagcttgcagcctctggatcaattacaatgcagaacattgga
gctatgtcaagctacctcttcatagtgaaatatgagttacctttggtgatccaggcatta
atgaacattgaagatacaactggattgtggtatctgaatggtgactatttggttctgctg
gtgtcgttggtgctcattcttcctttgtcactgctgagaaatttaggatatttgggatat
accagtggcctctccttgttgtgtatgatgttctttctgattgtggtgatttgcaagaaa
tttcagattccctgtcctatggaaattgcttacctagttaatgaaacaataaacagcacc
ttaacacagccagcttttgcacctgatgtgacatttaacatgactgaagatgattcttgc
agaccacgttactttatcttcaattcacagactgtctatgctgtgcccattctgaccttt
tcatttgtctgccaccctgctattcttcccatttacgaagagctaaaagaccgcagccgt
aaaagaatgatgaatgtgtccaagatttcattttttgccatgttcctcatgtacctgctt
gctgccctctttggatacctgacattttatgaacatgttgaggcagaattgcttcatacc
tactcaaccatgctgggaactgatatccttcttctcattgtccgcttggccgtgttgatg
gccgtcaccctgacagtaccagtcgttattttcccgatccggagttccgtaactcatttg
ttgtgtgcaggaaaagatttcagttggtggcgtcatagtttcattacagtgtctatcttg
ggacttacgaatttgcttgttatctttgtaccaactattagggatatctttggtttcatt
ggtgcatctgccgctgctatgttgatttttattcttccatctgccttctatatcaagtta
gtgaagaaagaatctatgaaatctgtacaaaagattggggctttgctcttcttgttgagc
ggcatagtggtgatgatcggaagcatgaccttgattgttttggattgggtgcacaatgcc
cctgcaggtggccactaa

DBGET integrated database retrieval system