KEGG   Loxodonta africana (African savanna elephant): 100673911
Entry
100673911         CDS       T04351                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain
  KO
K08522  glycoprotein hormones alpha chain
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04912  GnRH signaling pathway
lav04913  Ovarian steroidogenesis
lav04917  Prolactin signaling pathway
lav04918  Thyroid hormone synthesis
lav04923  Regulation of lipolysis in adipocytes
lav04929  GnRH secretion
lav05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100673911 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100673911 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100673911 (CGA)
   04929 GnRH secretion
    100673911 (CGA)
   04912 GnRH signaling pathway
    100673911 (CGA)
   04913 Ovarian steroidogenesis
    100673911 (CGA)
   04917 Prolactin signaling pathway
    100673911 (CGA)
   04918 Thyroid hormone synthesis
    100673911 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100673911 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 100673911
NCBI-ProteinID: XP_003404412
UniProt: A0A0F7RQT3
LinkDB
Position
Unknown
AA seq 120 aa
MDYYRKYAVVILATLSVFLHLLHSFPDGEFALQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKTFTKATVMGNAKVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactacagaaaatatgcggttgtcattctggccacactgtctgtgtttctgcat
ctcctccattcctttcctgatggagagtttgcattgcagggttgcccagaatgcaagcta
aaggagaacaaatacttctccaagctgggagccccaatttatcaatgcatgggctgctgc
ttctccagagcatatcccactccagcgagatccaagaagacaatgttggttcccaaaaac
atcacctcagaggccacgtgctgtgtggccaaaacatttaccaaggccacagtcatggga
aatgccaaagtggagaaccacacggagtgccactgcagcacctgctactatcacaaatct
taa

DBGET integrated database retrieval system