KEGG   Loxodonta africana (African savanna elephant): 100673992
Entry
100673992         CDS       T04351                                 

Gene name
NOS1
Definition
(RefSeq) nitric oxide synthase, brain isoform X2
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00220  Arginine biosynthesis
lav00330  Arginine and proline metabolism
lav01100  Metabolic pathways
lav04020  Calcium signaling pathway
lav04145  Phagosome
lav04371  Apelin signaling pathway
lav04713  Circadian entrainment
lav04730  Long-term depression
lav04926  Relaxin signaling pathway
lav04970  Salivary secretion
lav05010  Alzheimer disease
lav05014  Amyotrophic lateral sclerosis
lav05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100673992 (NOS1)
   00330 Arginine and proline metabolism
    100673992 (NOS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100673992 (NOS1)
   04020 Calcium signaling pathway
    100673992 (NOS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100673992 (NOS1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100673992 (NOS1)
  09154 Digestive system
   04970 Salivary secretion
    100673992 (NOS1)
  09156 Nervous system
   04730 Long-term depression
    100673992 (NOS1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100673992 (NOS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100673992 (NOS1)
   05014 Amyotrophic lateral sclerosis
    100673992 (NOS1)
   05022 Pathways of neurodegeneration - multiple diseases
    100673992 (NOS1)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100673992 (NOS1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 100673992
NCBI-ProteinID: XP_010597242
UniProt: G3TS49
LinkDB
Position
Unknown
AA seq 1434 aa
MEEHMFSVQQIQPNVISVRLFKRKVGGLGFLVKERVTKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNGRPLVDLTYDSALEVLRGVASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTRPLGPATKAVDLSHQPSTSKEKPLAVDGSLGPGNRPQHAQDNRQEAGSLSHANGLAP
RPMSEDSAKKSASTGLQGGGENNDLLKEIEPVLNLLTSGSKGINGGRPAKVEMKDAEIQV
DRDLDGKPHKPLPLGVENDRVFNDLWGKGNVPVVLNNPYSEKEQPPASEKQSPTKNGSPS
KCPRFLKVKNWETDVVLTDTLHLKSTLESGCSEHICMGSIMLPSQQIRKPEEVRTKEQLF
PLAKEFIDQYYSSIKRFGSKAHMDRLEEVNKEIETTSTYQLKDTELIYGAKHAWRNASRC
VGRIQWSKLQVFDARDCTTAHGMYNYICNHIKYATNKGNLRSAITIFPQRTDGKHDFRVW
NSQLIRYAGYKQPDGSILGDPANVEFTEICIQQGWKPPRGRFDVLPLMLQANGNDPELFQ
IPPELVLEVPIRHPKLEWFKDLGLKWYGVPAVSNMLLEIGGLEFSACPFSGWYMGTEIGV
RDYCDNSRYNILEEVAKKMNLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSAT
ESFIKHMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPCFEYQPDPWNTHV
WKGTNGTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKSLCE
IFKHAFDAKVMSMEEYDIVHLEHETLVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSIQ
EERKSYKVRFNSVSSYSDSRKSLGEGPDLRDNFESAGPLANVRFSVFGLGSRAYPHFCAF
GHAVDTLLEELGGERILKMGEGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANN
SLISNDRSWKRNKFRLTYVAEAPELTQGLSSVHKKRVSAARLLSRQNLQSPKSSRSTIFV
RLHTNGNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPTNQLVKVELLEERNTALGV
ISNWTDEHRLPPCTVFQAFKYYLDITTPPTPLQLQLFASLATSEKEKQRLLVLSKGLQEY
EEWKWGKNPTIVEVLEEFSSIQMPTTLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIV
SYRTQDGEGPIHHGVCSSWLNQIQADEVVPCFVRGAPSFRLPRNPQVPCILVGPGTGIAP
FRSFWQQRQFDIQHKGMSPCPMVLVFGCRQSKIDHIYKEETLQAKNKGVFRELYTAYSRE
PEKPKKYVQDILQEQLAEPVYQALKEQGGHIYVCGDVTMAADVLKAIQRIVTQQGKLSVE
DAGVFVSRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4305 nt   +upstreamnt  +downstreamnt
atggaggaacatatgttcagtgtccagcaaatccaacccaacgtcatttctgtccgcctc
ttcaagcgcaaagtgggaggcctgggcttcctggtgaaggagcgggtcaccaagccaccc
gtgattatttccgacctgattcgagggggtgctgcagagcagagcggcctcatccaggct
ggagacatcatcctggccgtcaatgggcggcccttggtcgacctgacctatgacagcgcc
ctggaggtgctcaggggcgttgcctctgagacccatgtggtcctcattctgaggggccct
gagggcttcaccacacacctggagaccaccttcactggggatggaacccccaagaccatc
cgggtgacacggcccctgggtcctgccaccaaagctgtcgatctgtcccaccagccatca
accagcaaagagaagccactggcggtggatgggtccctggggcctggaaaccggcctcag
catgcccaagacaacaggcaggaagctggctcactctcgcacgccaatggcctagccccc
aggcccatgagtgaggactctgccaagaaaagtgccagtactggtctccaaggaggtggg
gagaacaatgacctgctcaaggagatagagcctgtgctcaacctcctcaccagtgggagc
aaagggatcaatggagggagacctgccaaggtggagatgaaagacgcagaaatccaggtg
gacagagacttggatggaaaaccacacaagccactgccccttggcgtggagaacgaccgc
gtcttcaacgacctgtgggggaaaggcaatgtgcctgtcgtcctcaacaacccatattca
gagaaggagcagcccccggcctcagaaaaacagtcccccacaaagaatggcagcccctcc
aagtgcccccgcttcctcaaggtcaagaactgggagactgacgtggttctcactgacacc
ctccaccttaagagcaccttggaatcgggatgctctgagcacatctgtatgggctctatc
atgctcccttctcagcaaatacgaaagcccgaagaagtccgcacgaaagaacagctcttc
cctctcgccaaagagtttattgatcagtactactcgtcaattaaaagatttgggtccaaa
gcccacatggacaggctggaagaggtgaacaaagagattgagaccaccagcacctaccaa
ctcaaggacacggagctcatctacggggccaagcacgcctggcggaatgcctcccgctgc
gtcggcaggatccagtggtccaagctgcaggtatttgatgcccgagactgcaccacggct
cacgggatgtacaactacatctgcaaccacatcaagtacgccaccaacaaagggaacctc
aggtctgccatcaccatatttccccagaggacagacggcaagcatgacttcagggtctgg
aactcccagctcatccgctatgcaggctacaagcagcctgatggctccatcctgggggac
ccagccaacgtggagttcacagagatctgcatacagcagggctggaagcccccccgaggc
cgcttcgacgtcctgccactcatgctgcaggccaacggcaacgaccccgagctcttccag
attcctccagagctggtgctggaggtgcccatcaggcaccccaagctcgagtggttcaag
gacctggggctgaagtggtatggtgtccctgctgtgtccaacatgctcctggagatcggt
ggcctggagttcagtgcctgtcccttcagcggctggtacatgggcacagagatcggcgtc
cgggactactgtgacaattcgcgctacaacattctggaggaagtggccaagaagatgaac
ttggacatgaggaagacatcttccctgtggaaggaccaggctctggtggagatcaacatt
gccgtcctctacagcttccagagtgacaaagtgaccatcgttgaccatcactctgccacg
gagtccttcattaagcacatggagaatgagtaccgctgccgggggggctgcccagctgac
tgggtgtggatcgtgccccccatgtctggcagcatcacccctgtcttccaccaggagatg
ctcaactaccggctcaccccctgcttcgagtaccagcctgatccttggaacacccatgtc
tggaaaggcaccaatgggacccccacaaagcggcgagccattggcttcaagaagctggca
gaagctgtcaagttctccgctaaactgatggggcaggcaatggctaagagagtcaaagcc
accatcctctatgccaccgagactggcaaatcgcaggcctatgctaaatccttgtgtgag
atcttcaaacacgcctttgatgccaaggtgatgtccatggaagaatatgacatcgtgcac
ctggagcacgaaactctggtcctggtagttaccagcacctttggcaatggagaccccccc
gagaatggggagaaattcggctgtgctttgatggaaatgaggcatcccaactctatacag
gaggagaggaagagctacaaggttcgattcaatagcgtctcctcctattcagactcccgc
aaatcactgggcgaagggcctgacctcagagacaactttgagagtgctggacccctagca
aatgtgaggttctcagtgtttggccttggctcacgggcataccctcacttctgcgccttt
ggacatgctgtggacaccctcctggaagagctaggaggggagaggatcctgaagatggga
gagggggatgaactctgtgggcaggaagaggctttcaggacctgggccaagaaggtcttc
aaggcagcctgtgatgtgttctgcgtgggggatgatgtcaacatcgagaaggccaacaac
tccctcatcagcaatgaccgcagctggaagaggaacaaattccgcctcacctatgtggct
gaggctccagaacttacacaaggtctatccagtgttcacaaaaagcgggtctcagctgct
cgactcctgagccgtcaaaaccttcagagtcctaaatccagccgatccaccattttcgtg
cggctccacacgaatgggaatcaggagctgcagtaccagcctggagaccacctgggtgtc
ttccccggcaaccacgaggacctggtgaatgccctgattgagcggctggaggatgcaccc
cctaccaaccagctggtaaaggtggagctgctggaggagcggaacacagctttgggtgtc
atcagtaactggacagacgagcaccgcctcccaccctgcaccgtattccaggccttcaag
tactacctggacatcaccacgccaccaacgcccttgcagctgcagctgtttgcctccctg
gccaccagcgagaaggagaagcagcgtctgctggtcctcagcaagggtttgcaggagtat
gaggaatggaagtggggcaagaaccccaccatcgtggaggtactggaagagttctcgtcc
atccagatgcccaccactctgctcctgacccagctatctctgctgcagccacgctactac
tccatcagctcctccccagacatgtacccggatgaggtgcacctcactgtggccatcgtc
tcctaccgtacccaagatggagaaggaccaattcatcacggcgtgtgctcctcctggctc
aaccagatacaggctgatgaagtggtcccctgttttgtgagaggagcacctagcttccgc
cttccccgaaatccccaagtgccctgcatcctggttggcccggggactggcatcgcccct
ttccgaagcttctggcagcagcgccaatttgatatccaacacaaaggaatgagtccctgc
cccatggtcctggtctttgggtgccggcaatccaagatagaccacatctacaaggaagaa
accctacaggccaagaacaagggggtcttcagagagctgtacacggcctactcccgggaa
ccagagaaaccaaagaagtacgtacaggacatccttcaagagcaattggctgagcccgtg
taccaagccctgaaggagcaagggggccacatttatgtctgcggggacgtcaccatggcc
gctgatgtcctcaaagccatccagcgcatcgtgacccagcaggggaaactctcagtggag
gacgccggcgtgttcgtcagtagactgagggatgacaaccggtaccatgaggatattttt
ggggtcaccctgcggacgtatgaagtgaccaaccgccttagatctgagtccattgccttc
attgaagagagcaaaaaagatacagacgaggttttcagctcctaa

DBGET integrated database retrieval system