KEGG   Loxodonta africana (African savanna elephant): 100674399
Entry
100674399         CDS       T04351                                 

Gene name
ACHE
Definition
(RefSeq) acetylcholinesterase isoform X1
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00564  Glycerophospholipid metabolism
lav04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100674399 (ACHE)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    100674399 (ACHE)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100674399 (ACHE)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:lav00537]
 Enzymes
  100674399 (ACHE)
SSDB
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Other DBs
NCBI-GeneID: 100674399
NCBI-ProteinID: XP_003422527
UniProt: G3T0J3
LinkDB
Position
Unknown
AA seq 614 aa
MRPPRCPLHMPSLASPLLLLLLFLLGGGTGAEGLEDPELLVTVRGGRLRGIRLMAPGGPV
SAFLGIPFAEPPVGPRRFLPPEPKRPWAGVLDVKAFQSVCYQYVDTLYPGFEGIEMWNPN
RELSEDCLYLNVWTPYPQPSSPAPVLVWIYGGGFYSGASSLDVYDGRFLAQAEGTVLVSM
NYRVGAFGFLALPGSREAPGNMGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASV
GMHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGSTGGNDTEL
VACLRTRPAQDLVDHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFQGLQVLVG
VVKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQVSDLVAEAVVLHYTDWLHPE
DPARLREAMSDVVGDHNVVCPVAQLAGRLATQGARVYAYTFDHRASTLSWPLWMGVPHGY
EIEFIFGLPLEPSLNYTVEERIFAQRLMRYWANFARTGDPNDARDPKAPQWPPYTAGAQQ
YVSLNLQPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFRRWSSYMVHWKN
QFDHYSKQDRCSDL
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgcggcctccgcggtgtcccctgcatatgccttccctggcttccccactccttctcctc
ctcctcttcctccttggaggaggtacaggggctgagggcttggaggacccagagctactg
gtgactgtgcgtgggggccggctacggggcatccgcctaatggctcctgggggccctgtc
tctgcttttctgggcattccttttgcggagccacccgtgggcccgcgtcgctttctgcca
ccagagcccaagcggccctgggcaggagtgctggacgtcaaggctttccagagtgtctgt
taccagtacgtggacaccctgtaccctggttttgaaggcatcgagatgtggaaccccaac
cgtgagctgagtgaggactgcctctacctcaacgtgtggacaccatacccccagccttca
tcccccgcccctgtcctggtctggatctatgggggtggcttttacagtggggcttcgtct
ctggatgtgtacgatggccgcttcctggcacaggctgaggggactgtgttggtgtccatg
aactaccgggtgggagcctttggtttcctggccctgccagggagccgggaggccccaggc
aatatgggtctactggatcagaggctggcactgcagtgggtgcaggagaatgtggcagcc
tttgggggggacccaacatcagtgacgctgtttggggagagtgcaggtgccgcctctgtg
ggcatgcacctgctgtccccccctagccggggcctgttccacagggctgtgctgcaaagt
ggggcacccaatggaccctgggccaccgtgggcgtgggagaagcccgccgcagagccaca
cttctggctcgtctcgtaggctgtcccccaggcagcactggtggcaatgacacagagctc
gtggcctgcctacggacacggccagcccaggacctggttgaccatgagtggcacgtactg
cctcaggaaagtgtcttccgcttctcctttgtgcctgtggtagatggagacttcctcagt
gacacacccgaggccctcatcaacgctggagacttccagggcctgcaggtgctggtgggt
gtggtgaaggatgagggctcctattttctggtttacggggccccaggcttcagcaaagac
aacgagtcactcatcagccgggcccagttcctggctggggtgcgggtcggggtcccccag
gtgagtgacctggtagccgaggctgtggtcctgcattacacagactggctgcaccctgaa
gacccagcacggcttagggaggcaatgagtgatgtggtgggtgaccacaacgtggtgtgt
cctgtggcccagctggctgggcgactggccacccagggtgcccgggtctatgcctacact
tttgaccaccgtgcctccacgttgtcctggcccctctggatgggggtgccccacggctac
gagatcgagttcatctttgggctccccctggaaccctccttaaactacaccgttgaagag
agaatctttgcccagcggctgatgagatattgggccaacttcgcccgcacaggggacccc
aatgatgcccgggacccaaaagccccgcagtggccaccgtacacggcgggcgcacagcag
tacgtcagcctgaacctacagccgctggaggtgcggcgggggctgcgcgcgcaggcctgc
gccttctggaaccgcttcctacccaaattgctcagtgccaccgacacgctggacgaggcg
gagcgccagtggaaggccgagttccgccgctggagctcctacatggtgcactggaagaac
cagttcgaccattacagcaagcaggatcgttgctcagacctgtga

DBGET integrated database retrieval system