KEGG   Loxodonta africana (African savanna elephant): 100674787
Entry
100674787         CDS       T04351                                 

Gene name
VASP
Definition
(RefSeq) vasodilator-stimulated phosphoprotein isoform X1
  KO
K06274  vasodilator-stimulated phosphoprotein
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04015  Rap1 signaling pathway
lav04022  cGMP-PKG signaling pathway
lav04510  Focal adhesion
lav04530  Tight junction
lav04611  Platelet activation
lav04666  Fc gamma R-mediated phagocytosis
lav04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100674787 (VASP)
   04022 cGMP-PKG signaling pathway
    100674787 (VASP)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100674787 (VASP)
   04530 Tight junction
    100674787 (VASP)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100674787 (VASP)
   04666 Fc gamma R-mediated phagocytosis
    100674787 (VASP)
   04670 Leukocyte transendothelial migration
    100674787 (VASP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:lav04812]
    100674787 (VASP)
   04147 Exosome [BR:lav04147]
    100674787 (VASP)
Cytoskeleton proteins [BR:lav04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100674787 (VASP)
Exosome [BR:lav04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100674787 (VASP)
SSDB
Motif
Pfam: WH1 VASP_tetra ASD2 Ran_BP1 DUF4852
Other DBs
NCBI-GeneID: 100674787
NCBI-ProteinID: XP_010584757
LinkDB
Position
Unknown
AA seq 381 aa
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIIRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGAPPP
PAAPPTWSVQNGPSPEEVEQQKRQQPSQPEHVERERRASSAGGPPAPPAGGPPPPPGPPP
PPGPPPPPGLPPSGVSAAGHGAGAGPPPAPPLPTAQGPSGGGAGAPGLAAALAGAKLRKV
SKQEEASGGPVAPKAESGRSTGGLMEEMNAMLARRRKATQVGEKPPKDESANQVEPEARV
PAQTESVRRPWEKNSTTLPRMKSSSSVTTSEANVFTPSSSDESDLDRVKQELIEEVRKEL
RKVKEEIIEAFVQELRKRGSP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagcgagacagtcatctgctccagccgggccactgtgatgctttacgatgacggcaac
aagcggtggctgcctgctggcacaggcccccaagccttcagccgtgtccagatctaccac
aaccccacggccaactccttccgggtcgttgggcggaagatgcagccagaccagcaggtg
gtcatcaactgtgccatcatccgaggtgtcaagtacaaccaggccactcccaacttccat
cagtggcgcgatgcccgccaggtctggggcctcaatttcggcagcaaggaagatgcagcg
cagtttgccgcaggcatggccagcgccctagaggcattggaaggaggggcgcctcctcca
cccgcagcacctcccacctggtcggtccagaatggcccgtccccagaggaggtggagcag
cagaaaaggcagcagccctctcagccggaacacgtggagcgtgaacgtagggcctccagt
gcaggaggcccgcctgcccccccagctggggggccacccccacctccaggaccgccccct
cctcctggtccccctccacccccgggtctgcctccctcaggggtctcagctgcagggcat
ggagcaggggcaggcccacctcctgcgccccctctgcccacagcacagggccccagcggc
ggaggggctggagcccctggactggccgcagcccttgctggtgccaaactcaggaaagtc
agcaagcaggaggaggcctcaggggggcccgtggcccccaaagctgagagcgggaggagc
acaggtgggctcatggaagagatgaatgccatgctggcccgtagaaggaaagctacacag
gttggggagaaaccccccaaggatgaatcagccaatcaggtggagccagaggccagagtc
ccagcccagactgaatctgtgcgaagaccctgggagaagaacagcacaactttgccaagg
atgaagtcgtcttcttcagtgaccacctccgaggccaatgtctttacacccagctccagt
gatgagtcagatctggacagggtgaaacaggaacttatagaagaggtgagaaaggaacta
cgaaaagtgaaagaggaaataattgaagcgtttgtccaggagctgaggaagcggggttcc
ccctga

DBGET integrated database retrieval system