KEGG   Loxodonta africana (African savanna elephant): 100674910
Entry
100674910         CDS       T04351                                 

Gene name
GHRH
Definition
(RefSeq) somatoliberin
  KO
K05260  growth hormone-releasing hormone
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04080  Neuroactive ligand-receptor interaction
lav04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100674910 (GHRH)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100674910 (GHRH)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 100674910
NCBI-ProteinID: XP_023406005
LinkDB
Position
Unknown
AA seq 102 aa
MLLWVFFLVVLTLSSDAHCSPPSLPLRTRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ
QGEQNQEQGARVRLGRQVESMWADQKQMALESVLVALLQKHR
NT seq 309 nt   +upstreamnt  +downstreamnt
atgctgctctgggtgttcttcctcgtggtcctcactctcagcagtgatgcccactgctcc
ccaccgtctctgcccctcaggacacggcggtatgcagatgccatctttaccaacagctac
cggaaggtgctgggccagctgtctgcccgcaagctactccaggacatcatgagcaggcag
cagggagagcaaaaccaggagcaaggagcaagggtgcgccttggccgtcaagtagagagc
atgtgggcagaccaaaagcagatggcattggagagcgtcctggtggccctgctgcagaaa
cacaggtag

DBGET integrated database retrieval system