KEGG   Loxodonta africana (African savanna elephant): 100675090Help
Entry
100675090         CDS       T04351                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00480  Glutathione metabolism
lav00980  Metabolism of xenobiotics by cytochrome P450
lav00982  Drug metabolism - cytochrome P450
lav00983  Drug metabolism - other enzymes
lav01524  Platinum drug resistance
lav05200  Pathways in cancer
lav05204  Chemical carcinogenesis
lav05225  Hepatocellular carcinoma
lav05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100675090
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100675090
   00982 Drug metabolism - cytochrome P450
    100675090
   00983 Drug metabolism - other enzymes
    100675090
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100675090
   05204 Chemical carcinogenesis
    100675090
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100675090
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100675090
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100675090
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lav02000]
    100675090
Enzymes [BR:lav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100675090
Transporters [BR:lav02000]
 Other Transporters
  Pores ion channels [TC:1]
   100675090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100675090
NCBI-ProteinID: XP_003409178
UniProt: G3TNV0
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSGRSARSLGKGSEPPGPVPEGLIRVYSMRFCPFAQRTLLVLNAKGIRHEVININLKNKP
EWFFTKNPLGLVPVLENSQGQLIYESTITCEYLDEVYPGKKLLPDDPYEKARQKMDFELF
SKVPPLMISTFRSQNKEECSGVKEELCKELSKLEEVLTNRKTAFFGGNSVSMIDYLIWPW
MERLEAMELSECVDHTPKLKLWIAAMLEDPAVSAVHMDAKAFQGFFKLYLQGSLEAYDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggaggtcagcccggagcctggggaaaggcagcgagcccccagggccggtcccg
gagggcctgatccgcgtctacagcatgaggttctgcccgttcgcgcaaaggacgctcctg
gtcctgaatgccaagggaatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggttctttacgaagaatccccttggtctggtaccagttctggaaaacagtcagggc
cagctgatctatgaatctaccatcacttgtgagtacctggatgaagtatatccagggaag
aagctgttaccagatgacccctatgagaaagctcgccaaaagatggactttgagttattt
tctaaggtaccacctttgatgataagcacttttagaagccaaaataaggaagagtgctct
ggtgtcaaagaagaactgtgtaaagaactcagcaagctagaggaggttctgaccaacagg
aagacagctttctttggtggcaattctgtgtctatgattgattacctcatctggccctgg
atggaacggctggaagcaatggagttatctgagtgtgtagaccacactccaaaacttaag
ctctggatagcagccatgttggaggatcctgcagtatccgccgtccacatggatgccaag
gccttccagggtttctttaaactctatttgcagggcagcctcgaggcctatgactacggg
ctctga

DBGET integrated database retrieval system