KEGG   Loxodonta africana (African savanna elephant): 100675105
Entry
100675105         CDS       T04351                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav01521  EGFR tyrosine kinase inhibitor resistance
lav04012  ErbB signaling pathway
lav04062  Chemokine signaling pathway
lav04110  Cell cycle
lav04150  mTOR signaling pathway
lav04151  PI3K-Akt signaling pathway
lav04310  Wnt signaling pathway
lav04340  Hedgehog signaling pathway
lav04360  Axon guidance
lav04390  Hippo signaling pathway
lav04510  Focal adhesion
lav04550  Signaling pathways regulating pluripotency of stem cells
lav04657  IL-17 signaling pathway
lav04660  T cell receptor signaling pathway
lav04662  B cell receptor signaling pathway
lav04722  Neurotrophin signaling pathway
lav04728  Dopaminergic synapse
lav04910  Insulin signaling pathway
lav04916  Melanogenesis
lav04917  Prolactin signaling pathway
lav04919  Thyroid hormone signaling pathway
lav04931  Insulin resistance
lav04932  Non-alcoholic fatty liver disease
lav04934  Cushing syndrome
lav04935  Growth hormone synthesis, secretion and action
lav05010  Alzheimer disease
lav05020  Prion disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05135  Yersinia infection
lav05160  Hepatitis C
lav05162  Measles
lav05163  Human cytomegalovirus infection
lav05165  Human papillomavirus infection
lav05167  Kaposi sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05210  Colorectal cancer
lav05213  Endometrial cancer
lav05215  Prostate cancer
lav05217  Basal cell carcinoma
lav05224  Breast cancer
lav05225  Hepatocellular carcinoma
lav05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100675105 (GSK3B)
   04310 Wnt signaling pathway
    100675105 (GSK3B)
   04340 Hedgehog signaling pathway
    100675105 (GSK3B)
   04390 Hippo signaling pathway
    100675105 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100675105 (GSK3B)
   04150 mTOR signaling pathway
    100675105 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100675105 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100675105 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100675105 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100675105 (GSK3B)
   04657 IL-17 signaling pathway
    100675105 (GSK3B)
   04662 B cell receptor signaling pathway
    100675105 (GSK3B)
   04062 Chemokine signaling pathway
    100675105 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100675105 (GSK3B)
   04917 Prolactin signaling pathway
    100675105 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100675105 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100675105 (GSK3B)
   04916 Melanogenesis
    100675105 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100675105 (GSK3B)
   04722 Neurotrophin signaling pathway
    100675105 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100675105 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100675105 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100675105 (GSK3B)
   05225 Hepatocellular carcinoma
    100675105 (GSK3B)
   05226 Gastric cancer
    100675105 (GSK3B)
   05217 Basal cell carcinoma
    100675105 (GSK3B)
   05215 Prostate cancer
    100675105 (GSK3B)
   05213 Endometrial cancer
    100675105 (GSK3B)
   05224 Breast cancer
    100675105 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100675105 (GSK3B)
   05020 Prion disease
    100675105 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100675105 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100675105 (GSK3B)
   04931 Insulin resistance
    100675105 (GSK3B)
   04934 Cushing syndrome
    100675105 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100675105 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100675105 (GSK3B)
   05162 Measles
    100675105 (GSK3B)
   05163 Human cytomegalovirus infection
    100675105 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100675105 (GSK3B)
   05165 Human papillomavirus infection
    100675105 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100675105 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lav01001]
    100675105 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lav03036]
    100675105 (GSK3B)
Enzymes [BR:lav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100675105 (GSK3B)
Protein kinases [BR:lav01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100675105 (GSK3B)
Chromosome and associated proteins [BR:lav03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100675105 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100675105
NCBI-ProteinID: XP_003413025
LinkDB
Position
Unknown
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagtaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccgcaggaagtcagctatacagacactaaa
gtgattggaaatgggtcgtttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaaaagatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgattgcgttatttcttctactcaagcggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccaccgg
gatattaaaccacaaaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagcgcaaagcagctggtccgaggagagcccaatgtttcctatatctgttctcgg
tactacagggcaccggagttgatctttggagccactgattacacctccagcatagatgtg
tggtctgcaggctgtgtgttggctgaactgttgctaggacaaccaatatttccaggggac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaatccaaattacacagaattcaaattccctcaaattaaggcacatcct
tggacaaaggtcttccgaccccgaaccccaccggaggccattgcactgtgtagccgtctg
ctggagtatacaccgactgcccgactgacgccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagagctgtccagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccctacaaatgccacagcagcctcagacgct
aacgctggagaccgtggacagaccaataacgccgcttccgcatcggcttccaactccacc
tga

DBGET integrated database retrieval system