KEGG   Loxodonta africana (African savanna elephant): 100676113
Entry
100676113         CDS       T04351                                 

Gene name
PDE11A
Definition
(RefSeq) dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
  KO
K13298  dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 [EC:3.1.4.17 3.1.4.35]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00230  Purine metabolism
lav01100  Metabolic pathways
lav04934  Cushing syndrome
lav05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100676113 (PDE11A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100676113 (PDE11A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100676113 (PDE11A)
Enzymes [BR:lav01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     100676113 (PDE11A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     100676113 (PDE11A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 HD
Other DBs
NCBI-GeneID: 100676113
NCBI-ProteinID: XP_003406019
LinkDB
Position
Unknown
AA seq 933 aa
MTTPGLDFGEVESFLDRHPELFEDYLLRKGKQEMVEKWLQRHSHGQGALGPRPTLAGTSS
LAHGGGRRSSIVGGGTGPNGSANSQPTPGGGDCSGVPLSPSWASGSRGDGSLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKSLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIQSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADTENSFKESMEKSSYSDWLINNSVAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNAKLKPMLDSVAV
NRSKWEELHQKRLLASAASPSPASLTVAAEDRK
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgacaacccctggcctggacttcggggaggtggaaagtttcctggacaggcacccagag
ttgttcgaagattacctgttgcggaaggggaagcaggagatggtggagaagtggctgcag
aggcacagtcatggtcagggggctttaggcccaaggcccactctggctggcaccagcagc
ttggctcatggcggtggcagaagaagcagcatcgttggtggtggcactggaccaaatggc
tctgccaacagccagcctactcctggtggtggggactgtagtggggttcctttgagtccc
agctgggccagtggcagccgaggtgatgggagcctgcagcgaagagcttctcagaaagag
ctaaggaagagttttgctcgctccaaggccatccatgtgaacaggacctacgatgaacag
gtgacctcccgggcccaagagcccctgagcagtgtgcggcggagggcgctgctccggaag
gcgagctctctgccccccaccacagcccacattctcagtgccctactggaatcgagggtg
aatctgcctcagtacccccctacagccatcgattacaagtgccatctcaaaaagcacaat
gagcgtcagttcttcctggaactggtcaaggatatctccaatgaccttgacctcaccagc
ctgagctacaagatcctcatctttgtctgcctcatggtagatgctgaccgctgctctctc
ttcttggtggaaggggcagctgctggcaagaagagcttggtctccaaattctttgatgtg
catgcaggaaccccactgctgccgtgcagcagcacagagaactcaaatgaggtgcaggtc
ccctggggcaaaggcatcattggctatgtcggggagcatggagaaacggtcaacattcct
gatgcctaccaggatcgaagattcaatgatgaaattgacaagctaactggatacaagaca
aaatcattactgtgcatgcctatccaaagcagtgatggcgagattatcggtgtggcccaa
gcaataaataagattcctgaaggtgctccatttactgaagatgacgaaaaagttatgcag
atgtaccttcctttttgtggaattgccatatccaatgctcaactctttgctgcctcaagg
aaagaatatgaaagaagcagggctttactagaggtggttaatgatctctttgaagaacag
actgacctggagaaaatcgtcaagaaaataatgcatcgggcccagactctgttgaaatgt
gaacgctgttctgttttactcttagaggacattgagtcaccagtggtgaagtttaccaaa
tcctttgaattgatgtccccaaaatgcagcgctgatactgagaacagtttcaaagaaagc
atggagaaatcatcatactcagactggctaataaataacagtgtggctgagctggttgct
tctacgggcctcccagtgaacatcagtgatgcctaccaggatcctcgctttgatgctgag
gctgaccagatatccggttttcacataagatctgttctctgcgttcctatttggaatagc
aaccaccaaataattggggtggctcaagtgttaaatagattggatgggaaaccttttgat
gatgcagatcagcgactttttgaggcttttgtcatcttttgtggccttggcatcaacaac
acaattatgtatgatcaagtgaagaagtcctgggctaagcagtctgtggctcttgatgtg
ctgtcctaccatgcgacatgttcaaaagctgaagttgacaagtttaaggcagccaacatc
cctctggtgtcagaacttgccatcgatgacatacattttgatgacttttctctcgacgtt
gacgccatgatcacggctgctctccggatgttcatggagctggggatggtacagaaattt
aaaatcgactatgagactctgtgtaggtggcttttgacagtgaggaaaaactatcgcatg
gttctgtaccacaactggagacatgccttcaacgtgtgccaactgatgttcgcgatgtta
actactgcagggtttcaagagattctgaccgaggtggaaattttagctgtgattgtgggc
tgcctgtgtcacgacctcgaccacaggggaaccaacaatgccttccaagctaagagcggc
tctgccctggcccagctctatggaacctctgccaccctagagcatcaccattttaaccat
gcagtgatgatccttcagagtgagggtcacaacatctttgctaatttgtcctccaaggaa
tatagcgaccttatgcagcttttgaagcagtcaatcttggcaacagacctcacgctgtac
tttgagaggagaaccgaattctttgaacttgtcagtaaaggtgaatatgattggaacatc
aaaaaccatcgtgatatatttcgatcaatgttaatgacagcctgtgaccttggagccgtg
accaaaccgtgggagatctccagacaggtggctgaacttgtaaccagtgagttctttgaa
caaggagatcgggagagatcagaactcaaactcactccttcagctatttttgatcggaac
cggaaagatgaactgcctcgattgcaattggaatggattgatagcatctgcatgcctttg
tatcaggcattggtgaaggtcaatgcgaaactgaagcccatgctggattcggtggctgtg
aacagaagtaagtgggaagagctgcaccagaaaaggctgctggcttcggccgcctcgccc
tctcctgccagcctcacggtggctgcagaggacagaaagtaa

DBGET integrated database retrieval system