KEGG   Loxodonta africana (African savanna elephant): 100676727
Entry
100676727         CDS       T04351                                 

Gene name
STX1A
Definition
(RefSeq) LOW QUALITY PROTEIN: syntaxin-1A
  KO
K04560  syntaxin 1A
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04130  SNARE interactions in vesicular transport
lav04721  Synaptic vesicle cycle
lav04911  Insulin secretion
lav05016  Huntington disease
lav05022  Pathways of neurodegeneration - multiple diseases
lav05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    100676727 (STX1A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100676727 (STX1A)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100676727 (STX1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100676727 (STX1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100676727 (STX1A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100676727 (STX1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lav04131]
    100676727 (STX1A)
Membrane trafficking [BR:lav04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    100676727 (STX1A)
SSDB
Motif
Pfam: Syntaxin SNARE GNVR DUF5856 Syntaxin_2 Ferritin FAD_binding_1 YtxH Laminin_II Fib_alpha Sec34 ETRAMP
Other DBs
NCBI-GeneID: 100676727
NCBI-ProteinID: XP_023411617
LinkDB
Position
Unknown
AA seq 296 aa
MKDRTQELRTAKDSDDDDDVTVTVDRERFMDEFFEQVEEIRGFVDKISESVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSESALRPCLGAKALQVRLLVSPWGLA
PLHWWVGSCVPLCAPSAGHLQTPRAPICSRGLSQILGMWDGTGGGSGEWGLSLSSPVLTQ
IIMDSSISKQALSEIEXRHSEIIKLENSIRELHDMFMDMAMLVESPARIPPGLQGEMIDR
IEYNVENSVDYVERAVSDTKKAVKYQSKARRKKILIVICCVVLGIVIASTFGGIFG
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgatgatgatgtc
actgtcaccgtggaccgagagcgcttcatggacgagttttttgaacaggtggaggagatc
cgtggcttcgttgacaagatctcggagagcgtggaggaggtgaagcggaagcacagtgcc
attctggcctcccccaaccctgacgagaagacaaaggaggagctggaggaactcatgtct
gacataaagaagacggcgaacaaagttcgttccaagttaaagagtgagtctgcgctcagg
ccttgtttgggagccaaggcactacaggtccgcctactcgttagcccctgggggctcgct
cccctgcactggtgggttggatcttgtgttcctctatgtgccccctctgctggccacctg
cagactccccgagcccccatttgttcccggggcctgagccagatcctgggcatgtgggat
ggtacgggtggcggcagtggtgagtggggactgtcgctcagcagccctgtgctcacccag
atcatcatggactccagcatctcgaagcaggcactgagcgagattgagnaccggcacagt
gaaatcatcaagctggagaacagcatccgtgagcttcatgacatgttcatggacatggcc
atgctcgttgagagcccagctcggatcccccccggcctgcagggggaaatgatagatagg
atcgagtacaacgtggagaactcggtggactacgtagagagggctgtgtctgacaccaaa
aaggccgtcaagtaccagagcaaggcccgccggaagaaaattctgattgtcatctgctgt
gtggtcctgggcatcgtcattgcctccactttcgggggcatctttggatag

DBGET integrated database retrieval system