KEGG   Loxodonta africana (African savanna elephant): 100677150
Entry
100677150         CDS       T04351                                 

Gene name
ADCYAP1R1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide type I receptor isoform X2
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04024  cAMP signaling pathway
lav04080  Neuroactive ligand-receptor interaction
lav04713  Circadian entrainment
lav04911  Insulin secretion
lav04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:lav00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100677150 (ADCYAP1R1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100677150 (ADCYAP1R1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100677150 (ADCYAP1R1)
   04924 Renin secretion
    100677150 (ADCYAP1R1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100677150 (ADCYAP1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lav04030]
    100677150 (ADCYAP1R1)
G protein-coupled receptors [BR:lav04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    100677150 (ADCYAP1R1)
SSDB
Motif
Pfam: 7tm_2 HRM Insulin_TMD Dicty_CAR
Other DBs
NCBI-GeneID: 100677150
NCBI-ProteinID: XP_003407040
LinkDB
Position
Unknown
AA seq 469 aa
MAASVLQTSLTALFLLPVVTTMHSDCIFKKEQAVCLEKIQRANDLMGLNDSSPGCPGMWD
NITCWKPARVGEMVLVTCPELFRIFNPDQAWETGTIGEFDFADSNSLDLSDMGVVSRNCT
EDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFR
KLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDNNHCFISTVECKAVMIFFHYCVVS
NYFWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLHFDDTGCWDM
NDNTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLI
PLFGIHYTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWK
VNRYFTTDFKHRHPSLASSGVNGGSPALHPEQEQLQIRMSGLPADNLAT
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggccgccagcgtcctgcagacctctctgactgctctcttcttgctgcctgtggtcacc
accatgcactctgactgcatcttcaagaaggagcaagccgtgtgcctggagaagatccag
agggcaaatgacctgatgggcttgaacgactcctcccctggctgccctggcatgtgggac
aacatcacttgttggaagcctgcccgtgtgggtgagatggtcctcgtcacctgccctgaa
ctcttccgaatcttcaacccagaccaagcttgggagaccggaaccatcggagagtttgac
ttcgctgacagtaactccttggatctctcggacatgggggtggtgagccggaactgcacg
gaggacggctggtctgagcccttccctcactactttgatgcttgtgggtttgatgagtat
gaatccgagactggggaccaggactactactacctgtcggtgaaggctctgtacacagtt
ggctatagcacgtcccttgtcaccctcaccactgccatggtcatcctgtgtcgcttccgg
aagctacactgcactcgcaacttcatccacatgaatctgtttgtgtcattcatgctgagg
gcaatctccgtcttcatcaaagactggatcctgtatgcggaacaggacaacaatcactgc
ttcatttccactgtggaatgcaaggccgtcatgattttcttccactactgcgtggtgtcc
aactacttctggctgttcattgagggcctgtacctcttcaccctgctggtggagaccttc
ttccctgagagaagatacttctactggtacaccattattggctgggggaccccaactgtg
tgtgtgacagtgtgggctgtgctgaggctccacttcgatgacacgggctgctgggatatg
aatgacaacacggctctgtggtgggtgatcaaaggccctgtggttggctcgataatggtt
aactttgtgcttttcattggcatcatcgtcattcttgtgcagaaacttcagtctccagac
atgggaggcaacgagtctagcatctacttacggctggcacgctccaccctgctgctcatt
ccgctgtttggaatccactacacggtctttgccttctccccagagaatgtcagcaagagg
gagagacttgtgtttgagctgggcctgggctccttccagggcttcgtggtggctgttctc
tactgttttctgaatggggaggtgcaggcagagatcaagcgtaagtggcggagctggaag
gtgaaccgctatttcaccacggacttcaaacaccgacacccatccctggccagcagcggg
gtgaacggaggcagcccagctctccatcctgagcaagagcagctccagatccgcatgtca
ggccttccggccgacaacctggccacctga

DBGET integrated database retrieval system