KEGG   Loxodonta africana (African savanna elephant): 100677598
Entry
100677598         CDS       T04351                                 

Gene name
FZR1
Definition
(RefSeq) fizzy-related protein homolog
  KO
K03364  cell division cycle 20-like protein 1, cofactor of APC complex
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav04110  Cell cycle
lav04120  Ubiquitin mediated proteolysis
lav04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:lav00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100677598 (FZR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100677598 (FZR1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100677598 (FZR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lav04121]
    100677598 (FZR1)
Ubiquitin system [BR:lav04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     100677598 (FZR1)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100677598
NCBI-ProteinID: XP_023396745
LinkDB
Position
Unknown
AA seq 502 aa
MEPGWAPHPLLPTIESPVSVLVLEPVASPAHRGSEGEAGQAARGQWVRRAGRRWVGVRRA
GRCWVGGEAGQAARGQWVRQAGRRWVGVRRAGRCWVKGVRRSWYCGVRVRRSGYCGVTVR
RAGRHRVGGQLCPANTLPLQVAEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVNFHR
INENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPE
KKSLFTYSLSTKRSSPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPE
LQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVSTAGGWGLHQPGEGRGWPIREHLL
GRRCACVHGALYFCGGVCVIRDMACFCREWLSRARPEGRVPVLLGCSRARESPWLPISKP
PHQPPGPTYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWN
VFSKTRSTKESVSVLNLFTRIR
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggagcccggctgggcccctcaccctctgctgcctaccatagaatccccagtctctgtg
ctcgtgctggaacccgtggcttcacccgcccacagggggtcagagggtgaggcgggccag
gcggcacggggtcagtgggtgaggcgggctgggcggcgctgggtcggggtgaggcgggcc
gggcggtgctgggtcgggggtgaggcgggccaggcggcacggggtcagtgggtgaggcag
gccgggcggcgctgggtcggggtgaggcgggccgggcggtgctgggtcaagggggtgagg
cggtcttggtactgtggggtcagggtgaggcggtccgggtactgtggggtcacagtgagg
cgggccgggcggcaccgggttggagggcagctgtgcccagcaaacactctgccactgcag
gttgcagagatgcggcgcaccctgacacctgccaactccccggtgtcctcgcccagcaag
cacggagaccgcttcatcccttcacgggctggggccaactggagtgtgaacttccacagg
atcaatgaaaatgagaagtcaccaagtcagaaccgcaaggccaaggatgccacctcagac
aacggcaaagacggcctggcctactcggccctgctgaagaatgagctgctgggggcaggc
atcgagaaggtgcaggacccgcagacggaggaccgccggctgcagccctccacaccggaa
aagaagagcctcttcacgtattccctcagtaccaagcgctcaagcccagatgacggcaac
gaggtgtccccatactccttgtcccctgtcagcaataagagtcagaagttgctgaggtca
ccacggaaacccactcgcaaaatctccaaaatccccttcaaggtcctggacgcccccgag
ctccaggacgacttctacctgaatctggtggactggtcttccctcaacgtgctcagcgtg
gggctggggacctgtgtgtacctgtggagcgcctgcaccagccaggtgagcactgcagga
gggtggggcctgcatcagccaggtgagggcagggggtggcctatcagggagcaccttttg
gggaggcggtgtgcttgtgtacatggagcgctatatttctgtgggggggtgtgcgtgata
cgggatatggcatgtttctgtagggagtggctgagtagggcgcggcctgagggaagggtg
ccagtgttgctggggtgttccagagccagagagagcccttggctacccatttccaaaccc
ccacaccaacccccagggccaacctactcgcagaaccagatcctggtctggaagtaccca
tccttgacccaggtggccaagctgacagggcattcctaccgtgtgctctacctggccatg
tcccctgatggggaggccatcgtcaccggggctggagacgaaaccctgagattctggaat
gtctttagcaaaacccgctcgacaaaggaatccgtgtctgtcctcaacctcttcaccagg
atacggtaa

DBGET integrated database retrieval system