KEGG   Lactobacillus sp. wkB8: LACWKB8_1143
Entry
LACWKB8_1143      CDS       T03355                                 

Definition
(GenBank) Serine/threonine protein kinase PrkC, regulator of stationary phase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
law  Lactobacillus sp. wkB8
Brite
KEGG Orthology (KO) [BR:law00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:law01001]
    LACWKB8_1143
Enzymes [BR:law01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LACWKB8_1143
Protein kinases [BR:law01001]
 Serine/threonine kinases: Other
  Bacterial family
   LACWKB8_1143
SSDB
Motif
Pfam: Pkinase PASTA PK_Tyr_Ser-Thr APH Seadorna_VP7 Pkinase_fungal RIO1 Kinase-like Kdo Haspin_kinase DUF1857 DUF3713
Other DBs
NCBI-ProteinID: AIS09413
LinkDB
Position
complement(1185810..1187795)
AA seq 661 aa
MINKGYLLGDRYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQKEPQTLARFQRE
ALATSELSHPNIVMVLDVGADHGLPYMVMEYVDGPDLKDYIRANSPLNLRLVIKIMDQIL
SAMSLAHKHNVIHRDLKPQNILMDKHGNIKIADFGIAVALNQNSVTQTNSAIGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGHVPFNGDSAVSIALKHAQEPIPSIRKQDPEVPQ
ALENVVLKATAKDPRDRYHSAKQMQDDLDTSLNPSRANEPLFNPTHGNNNDETIILPNFK
PNSKQKEEIKEDQTNTENMTENSHPKKASFTQAMRKHKWWWLFIGFAAVLIAGLMIFVLT
NNSRKDVRIPDVTNLSEKKARNELENVGLKVGRIKHKSSDSIDQGKVIKTTPPAGSQIKR
GRFIDLYVSDGAGMVKVPDVTGDEYEIAVEKLEKMGFEVIRENQFSASVPPNHVIGQSIA
ADVEVKPTQTTITLTVSKGKNDRAKHHMIKLPDLKDYSLKDAQEYAHKHGLTLQVSSAYS
SKVKKGMIISMSPAAGTEVPRGSTISISVSEGQKKERNLTAIKNFTVSYENNDEDDSDNN
RGNHIQIYIADDNHSIDDIYRDLYIKRDMNFSIPFQLKDGPGALKVVRDGQTILSEKVKN
G
NT seq 1986 nt   +upstreamnt  +downstreamnt
gtgattaataaaggctatctactgggagatcgttaccggattattgatacgttgggcgaa
ggtgggatggctaatgtttatctcgctgaagatattatcctgcaacgcaaagttgcggta
aaaatattacgcttagatttacaaaaagaaccgcaaacattagcacgttttcaaagagaa
gctttagcgacaagtgaattaagtcatccgaatattgttatggtgcttgatgttggagca
gatcacggcctgccttacatggtcatggaatacgtcgatggtccagatctaaaggactat
attagggctaattcacctttaaatttaagacttgtaattaaaattatggatcaaatttta
agtgcaatgtctttagcgcataaacataatgttattcaccgcgatcttaagccgcaaaac
attttaatggataagcatggcaatattaaaattgctgattttggtattgcagttgcctta
aaccaaaattcagttactcaaactaactctgctattggttcagtgcactacatgtctcct
gaacaaacacgcggtgggctggttaccaagcagtcagatatttattctttaggaataatt
ttatatgaattaattactggacatgtaccatttaatggcgattcagccgtttctatagct
ttaaaacacgctcaggagccaattccttcaattagaaagcaggatcctgaggtccctcaa
gcgctggaaaatgttgttttaaaagcaactgccaaagatccaagagatcgctatcattct
gctaaacaaatgcaagatgatttagatactagccttaatcccagccgcgctaacgaaccg
ctttttaatccgacacatggtaataataatgatgaaacaattattttacctaattttaag
cctaattctaagcaaaaagaagaaataaaagaggaccagaccaacactgagaacatgaca
gaaaattctcaccccaaaaaagccagttttacgcaggcaatgcgcaagcataaatggtgg
tggctgtttatcggttttgctgccgttttaattgctgggttaatgatttttgttctgacc
aataatagtcgtaaggatgtgcgcatacctgatgtaacaaatttaagcgaaaaaaaagcc
cggaatgagcttgaaaatgtaggcttaaaagttggtcgaataaagcataaaagttctgat
agtattgatcagggtaaagtcattaagactacgcctccagcaggttcacaaataaagcgg
ggcagatttatcgatctttatgtttctgacggtgccggcatggttaaagtaccggatgtg
actggggatgaatatgaaattgcagttgaaaaactagaaaagatgggttttgaagtaatt
cgcgaaaatcagttttctgctagcgtgccacctaatcatgttattgggcagagtattgca
gcagatgttgaagtcaaacctacacaaactactattactttaaccgtttcaaaaggtaaa
aacgatcgtgccaagcatcatatgattaaattgccggacttaaaagactattccttaaaa
gatgcccaagaatatgcccacaagcatggacttactttgcaggtaagttcagcatactcg
tctaaggtaaaaaagggtatgataatttcaatgagtccagctgcaggaacagaagtacca
cgtggaagtacaatttctatcagtgtttccgaagggcagaaaaaggagcgcaatcttact
gcaattaaaaacttcacagtcagctatgaaaataatgatgaagatgattccgataacaat
cgtggcaatcatatccaaatttacattgcagatgacaatcattcaattgacgacatatat
cgcgatttatacattaaacgagatatgaacttttcaatcccgttccagcttaaagatggg
cctggcgcacttaaggttgttcgcgacggtcaaactattttaagtgagaaggtcaaaaat
ggctaa

DBGET integrated database retrieval system