KEGG   Laccaria bicolor: LACBIDRAFT_305994Help
Entry
LACBIDRAFT_305994 CDS       T01044                                 

Definition
(RefSeq) glycosyltransferase family 15 protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
lbc  Laccaria bicolor
Pathway
lbc00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    LACBIDRAFT_305994
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lbc01003]
    LACBIDRAFT_305994
Enzymes [BR:lbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     LACBIDRAFT_305994
Glycosyltransferases [BR:lbc01003]
 Glycan extension
  Yeast mannan chain
   LACBIDRAFT_305994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 6070164
NCBI-ProteinID: XP_001874860
JGI: 305994
UniProt: B0CSG0
LinkDB All DBs
AA seq 396 aa AA seqDB search
MMTNMRYLFLALAIIISLHYILSFSHEAYGRATSISNIKDHITGSQNRIPPYKIPIPEEY
YAHPDAGSSQGRKANAAIVMLARNGDLNGVISSMKQMEDRVNKKFHYPYVFLNDEPFSDD
FKTRVSEITDSKVQFGLIPNDHWNQPAWVNETKATESRNDMVKNNVIYGGSVPYRNMCRF
NSGFFYQHELLKPYKYYWSMYSNIDMVHACIYLSFPHRPDIKFFCDLDYDPFLIMQDQNK
VYGFTVSLYEYEATIPTLWNAVKSFIEKYPNLVSPDNAMAFLSDDGGETYNRCHFWSNFE
IGDLDLWRGEAYSKFFEHLDEQGGFYYERWGDAPVHSIGAALFAKKEQIHFFNDIGYRHE
PFQHCPQGDAHKKGKCWCDSAQNFGRHLPYNGKTGR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgaatatgcgctacctgtttcttgcgctcgcaattatcatcagcttgcactac
atcctaagcttctcccatgaagcctacggcagagcaacctcaatatcgaacatcaaagac
catataactggtagccaaaaccgcattccaccttacaagattcctataccagaggagtac
tatgctcacccagatgctggaagttcacaaggacgcaaggccaacgctgccattgttatg
ctcgcacgaaacggcgacctcaatggtgttataagtagcatgaagcagatggaggacaga
gttaacaaaaagttccattatccttatgttttcctcaacgacgaacctttcagtgacgac
ttcaagactcgtgtgtctgaaattacagactctaaggttcaatttggcctcatcccaaat
gaccactggaatcaacctgcgtgggttaatgagacgaaagcgacagagagccggaacgac
atggtgaaaaacaatgtcatttacggaggcagcgttccataccgaaatatgtgccgcttt
aattccggcttcttctatcaacacgaacttttgaagccatacaaatattactggagtatg
tactcgaatatcgatatggtccacgcttgcatttacctctcttttcctcacaggcccgac
atcaaattcttttgtgatctcgattatgatccgttcttgatcatgcaagatcagaataaa
gtctatgggttcaccgtgtctctctacgaatatgaagcaaccattcccacactctggaac
gcagtaaaaagtttcatagagaaataccctaatttagtatcgcctgacaacgcaatggct
ttcctttcggatgacggaggagagacttacaatcggtgccacttttggagcaatttcgaa
atcggcgaccttgacctttggcgaggtgaagcgtactcaaagttcttcgaacatctagat
gaacaaggtggtttttattatgaacgctggggagatgccccagtccatagtattggggca
gctctatttgccaagaaggaacaaattcatttcttcaacgatatcggttatcgtcacgaa
ccattccaacactgtccacaaggcgatgcccacaaaaaagggaaatgttggtgtgattca
gcacaaaattttggtaggcatctcccctacaatgggaaaactggcagatga

DBGET integrated database retrieval system