KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3008Help
Entry
LEPBI_I3008       CDS       T00693                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LEPBI_I3008 (ahpF)
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LEPBI_I3008 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 FAD_oxidored Thioredoxin_3 DAO Thi4 NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ABZ99075
UniProt: B0SPG9
LinkDB All DBs
Position
I:complement(3121529..3123088)
Genome map
AA seq 519 aa AA seqDB search
MLDESTKQQVKQYFERIKNPVSITLYSGDHEKREELVSFLNDIESLSPMISIQHSSDVTD
GLRFTIISNGNPTGIHFSGIPMGHEFTSFILAILQSGGNPIKLEEGILSAVSKLKGEFRF
ETFISLDCHNCPEVVQTLNSFALVNPNISHNMIDGAMYPELVKEKNIQGVPAVYLNGERF
LSGKAEASIIFDKLLELYTIPSESESSDGLANPSEIYDVTVIGGGPSGVTAAVYAARKGL
RTLVIADRLGGQVKDTLGIENIISIPYTTGPELIHVLADQLEKNQIKKKENVRVQKIEQG
QTKIIHLNTGEKILSKTVILSTGAKWRELNVPGEKEFVGKGVAYCPHCDGPFFKDKDVAV
IGGGNSGVEAALDLSGIVKSVTLVEFGDKLNADKVLLDKVASSPNIKTLVKAQTTEIQTG
VDKVTGLTYKDRNTEQVSTIPLDGVFVQIGLVPNSSFVKDLVATNRFGEILVDEKCKTNV
DGIFACGDVTNTPYKQIIIAMGEGAKAAISAFEYLLHAA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgaatcaaccaaacaacaagtaaaacaatactttgaaaggattaaaaatcca
gtcagcattacattgtattctggtgaccatgaaaaaagggaagagttagtttcctttctc
aatgatatcgaatcattgagtccaatgatatcaatccaacactcaagtgatgtcactgat
ggactacgattcacgattatatcaaacggaaatcctactggaatccatttctcaggaatt
cccatgggacatgaatttacttccttcatactagcgattttacaatccggaggtaatccg
atcaaattggaagaagggattctttctgcggtttccaaattgaaaggtgagtttcggttt
gaaacatttatttcccttgattgccataattgccctgaggttgtgcaaactctaaacagc
tttgctttggtgaatcccaacatctcccacaacatgatcgacggagcgatgtatcctgaa
ttggtgaaagaaaaaaatatccaaggtgttcctgctgtatatttgaacggagaacgtttt
ttaagtggaaaagcagaagcatcgatcatttttgataaacttttggaattatatacaatt
ccctctgagtcagaatctagcgatggtttggcgaatccttctgaaatttatgatgtcact
gtcattggtggtggtccatctggagtgactgcagccgtttatgccgcaagaaaaggactt
agaactctagtgattgccgatcgattgggtggacaagtaaaagatactttgggtatcgaa
aatattatctcaattccatatacaactgggcctgaattgatccatgtcttggctgaccaa
cttgaaaaaaaccaaatcaaaaagaaagaaaatgttcgggttcaaaaaatagaacaagga
caaacaaaaatcattcacttgaacactggtgagaaaatcctttccaaaactgtgattttg
tctactggcgcaaaatggagagaactcaatgttccaggtgaaaaggagttcgttggaaag
ggcgttgcttattgccctcactgtgatggtccattttttaaagacaaagatgtggctgtg
atcggtggaggaaactcgggagtggaagcagctttagatttaagtggaattgtgaaatct
gtcactttagttgagtttggtgataaattaaacgcagacaaggtgttattggataaggtg
gcaagttctccaaacatcaaaactttggtcaaagcgcaaaccactgaaattcaaacaggt
gtagataaagtcacagggcttacctacaaggatcgaaatacagaacaagtatcaacgatt
ccattggatggagtgtttgttcagatcggtcttgtaccaaacagtagttttgtgaaagac
ttagtggcaacgaatcggtttggagaaattttggtcgatgaaaagtgtaaaaccaatgtg
gatggaatctttgcttgtggggatgtgacaaatacaccttacaaacaaattatcattgca
atgggagaaggggcaaaggcggcaatcagcgcttttgaatatctactacacgcggcctaa

DBGET integrated database retrieval system