KEGG   Lactobacillus casei BL23: LCABL_24350Help
Entry
LCABL_24350       CDS       T00723                                 

Gene name
asnA1
Definition
(GenBank) L-asparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00250  Alanine, aspartate and glutamate metabolism
lcb00460  Cyanoamino acid metabolism
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LCABL_24350 (asnA1)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LCABL_24350 (asnA1)
Enzymes [BR:lcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     LCABL_24350 (asnA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase Asparaginase_C
Motif
Other DBs
NCBI-ProteinID: CAQ67501
LinkDB All DBs
Position
2390033..2391007
Genome map
AA seq 324 aa AA seqDB search
MTKHILVLHTGGTISMTENSEGDIMPSQHNPLLGADSFVPADVELTTEEIFNLPSPHMTP
ERMLELVKRIRQAEKEGSDGVVITHGTDTLEETAYFLDLTLDSAMPVVVTGAMRSSNEIG
SDGLENLQSAIKTAASDDSRNKGTLVVMNDEIHTARFVTKTHTTNVATFRTPTFGPVGLV
TKDGVRFFQELINQEICAIDHLVNKVFLIKAYAGMDGTLFDALPEDTHGLTIEALGAGNL
PPTTLPAIQRLLDRNIPIVLVSRCFNGVAQAVYNYEGGGVQLKKMGIIFCQGLNGQKARI
KLQVGLSDGKQGQDLADFVDNAVS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaacatattctcgttttgcatacgggtggtaccatttcgatgactgaaaatagc
gaaggtgacattatgcccagccaacataacccgttacttggtgctgacagttttgtccct
gctgacgtcgaactcaccactgaagaaattttcaacctcccatccccgcacatgacccca
gaacggatgctagaactcgttaaacgcatccgccaagcggaaaaagaaggcagcgatggc
gtcgtgatcactcacgggacggatacgctggaagaaaccgcctattttcttgatctgacc
cttgattcggcgatgccagtggtcgtgacaggcgctatgcgctctagtaacgaaatcggc
agcgatggtctggagaatcttcaaagcgccattaaaacggctgccagcgacgactcacgc
aataagggaacgctcgttgtcatgaatgacgaaattcataccgctcggttcgtgaccaag
acgcacacgaccaacgtggctactttccgaacaccaacattcggtccagtcggtttggtc
accaaagatggcgtccgattctttcaagaactgattaatcaagaaatctgtgcgattgat
cacctcgtcaacaaggtcttcctcatcaaagcatatgctggcatggatggtaccttgttc
gatgcactgcctgaagatacccacggcttgacgattgaagcgctcggtgccggcaatcta
ccgccgaccaccttacctgccattcaacggctgctggatcgcaacatcccgattgttctc
gtttcccgctgttttaatggtgttgcgcaagccgtttacaattacgaaggcggtggtgtg
caacttaagaaaatgggcatcattttctgtcaaggcttgaatggccaaaaggcacgaatt
aagttgcaagtcggcctcagtgacggcaaacaggggcaggatctagccgacttcgtggat
aatgctgttagctga

DBGET integrated database retrieval system