KEGG   Latimeria chalumnae (coelacanth): 102348617
Entry
102348617         CDS       T02913                                 

Gene name
TMEM25
Definition
(RefSeq) transmembrane protein 25
  KO
K22652  transmembrane protein 25
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:lcm04515]
    102348617 (TMEM25)
Cell adhesion molecules [BR:lcm04515]
 Immunoglobulin superfamily
  TMEM25
   102348617 (TMEM25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set TMEM154 RIFIN
Other DBs
NCBI-GeneID: 102348617
NCBI-ProteinID: XP_005988206
Ensembl: ENSLACG00000018106
UniProt: M3XIY8
LinkDB
Position
Un
AA seq 368 aa
MTSPRISELFQAFLLLHVESIIQSGSGEPAPKINGRSTTVATLEENSTKDFTCQTEGWKS
APSLTWYLNGKKQKVNETGIIATTGEVFNRSTSTFTVTAHRTDRELNCSVIDPATGKVEN
ATVILNVQFMPEIVKMDVHYQERKEPGLFLVMFVLVKANPPANITWVDDDGRLVTNTSDF
MILDTKSYPWLTNHTVHVQLTSVTRNFSFTAGNSMGVINSSIASPGFLHSHIEVPVLGII
VGGVLAFLTILVLNVIVFCTIYRRKRKMQDRVEDSSLPQSESINIKFDEIRLPRENMSLP
SNLQLNDLNRPSKEVGGDVRKQFGHREEEDDFSEQESSSAFGNRGFVRFPMVGYIYKVSS
MSSDEIWL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgacgtcccccaggatcagtgaactctttcaggccttcctgcttctccatgttgagtca
atcatccaatcagggtctggagagccggcacccaaaataaacggaaggtccaccacagtt
gccaccctggaggagaacagcaccaaagacttcacttgccagacagaaggctggaaatca
gccccctccctcacctggtacctgaatggcaagaaacaaaaggtcaacgagacgggcata
atcgccaccaccggtgaggtgttcaaccggagcacaagcaccttcactgtgacagcgcac
aggaccgaccgggagctcaactgttccgtgattgacccggcgaccggcaaagtcgaaaac
gccaccgtcattttgaatgtgcaatttatgcctgaaatagtgaaaatggatgtccactat
caagaaaggaaggaacccggactgtttctggtcatgtttgtcctagtgaaggcgaaccct
cctgccaatatcacctgggtggacgacgatggccgtttggtcaccaacacgtctgacttc
atgattctggacacaaagagctacccgtggctgaccaatcacactgtccatgtgcaacta
accagcgtcaccaggaacttctccttcacggccgggaacagtatgggagtcatcaactca
tccatcgcctcccctggatttctccactctcacattgaagtgcctgtcttgggaatcatt
gtcggaggagtcttggcgttcctaaccatcctggttctcaacgtgattgtattttgcacc
atttacaggaggaaaaggaagatgcaggatagagttgaagacagctccctgcctcaaagt
gagtctatcaatattaagtttgatgagattcgccttcccagagagaacatgtccctccca
tcaaatctacagttaaacgatttaaacaggcccagtaaagaagtgggtggagatgtgaga
aagcagtttggccacagagaggaggaggacgacttctcggagcaggaaagctcatccgca
tttggtaacagaggttttgtgcgctttccaatggtgggctacatctacaaagtgtccagt
atgagcagcgatgaaatctggctgtga

DBGET integrated database retrieval system