KEGG   Latimeria chalumnae (coelacanth): 102354343
Entry
102354343         CDS       T02913                                 

Gene name
ATR
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm03460  Fanconi anemia pathway
lcm04110  Cell cycle
lcm04115  p53 signaling pathway
lcm04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102354343 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102354343 (ATR)
   04115 p53 signaling pathway
    102354343 (ATR)
   04218 Cellular senescence
    102354343 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcm01001]
    102354343 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lcm03400]
    102354343 (ATR)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102354343 (ATR)
Protein kinases [BR:lcm01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102354343 (ATR)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102354343 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I THP2
Other DBs
NCBI-GeneID: 102354343
NCBI-ProteinID: XP_014348069
Ensembl: ENSLACG00000009886
LinkDB
Position
Un
AA seq 2624 aa
MTEQGLEMASMIPALRELESVSPEDYNTVVQKPRQILCQFIDRILTDVSVVALELSKKSE
PQPTSVMLLDFIQHIMKSSHLMFVNAVSGLQQQSGVEHSCIDFSNWIITRLLRIAAAPNC
QALHKKIANVIRSLFFLFKNKSSSILGIMAKELLGLFEDLIFLHERHLQMQLAEDVRIWP
VTLKRFLVKRKDAGYLTPASLQLASISNVEPLEITLLQVLSDIFPTIFFRQQNLIMWNIG
CALLQHGSPKAKGMTMDFLTQTIHLGGPPEQPAGYFFTVFLEIMASLKAINTRELEIIEE
PLAQLVRTMFPLEAEAAGTIEPVYLNMLIEKLSDVLDGGLLNYLKSRKLKAAFCNLIQYF
QRFVPLGYESALVIRRQRVNVICRALINMIGVETQQEYILGSLYVALKSEVMELLQELQS
QIAPQIDSSDTDGGSSSSDEVLRKRPRLSLSIKRSRKPLTSAETIPFRMGPMDMTVKSKL
WSALCQQLPKLLSLLQEKEPQNQVTGTFEGIAVIVQLAALCTAHCSQISNSNTEKNTTKQ
GSDDKTNLQGVNLLRVQLVWISSEVIGTVLKGSKKQLECPVKGGEIRPVIDKIVKIIDAV
LYLQVRRPLDADILKIVCDVLSLPWIHSLSNDPAFKAVEFSPDLITLSHRLSGSFSQQTQ
SHCVYLLSLLPKEVSLEWRLAVYRRTLQSPSEVVRTGSIKGFPILLHNLGAKSHGLIQEI
LIEKLKDDSDLVRQELASIIGCLACELSGTFEMKLPSTEPVLHQADYDLLCNYLTVNCEC
VPVAPPIEASVFTPFLELLNAQVLSSIKFAFIDNIPHLCKHVKVGKGDLDSKAFTAVLLN
LVEDPGKDIRVAFSENIKYLLESIESEDLQKELLVSRLKVAYTNAKMSRNNELKETLIIT
TGEIGRAAKGELVVFALLHLLHCLLSKSTFVAGAARTEITELAAARSMKLQSFFSQYKKP
ICQFLVESLHSSQIALNSPSGQSDEMRQQEVAHRREVALDILTEIAHVFDFPDLNRFLTR
TLQLLLPYLAAKASLTASALIRTIAKQLAVNRREILINNFKYIFSHLVCSCSKDELECAL
HYLQNETEIELGSLLRQDYQGLHNELLLRIGEHYQQVFNGLAILASFASGDDPYQGPRDI
TAPELMADYLQPRLLGILAFFNMHLLSSSVGVEDKKMALSSLVSLMKLMGPKHISSVRVK
MMTTLRTGLRYKDDFPELCCKAWDCFVRCLDQPYLGSLLSHMIVALLPLIHIQPKETAAI
FHYLIVENRDAVQDFLHEIYFLPEHPELEQIQKVLQDYRKETSKSTDLQTELQLSMKAIQ
HENVDVRVHALTTLKETLHKNQEMLIKYATDCETVEPVISHLVTVLLIGCRDATPQALLL
CGECLGELGAIDPGRLDFTTSDNQGTGFTFVTGVEDPNFAYELLMELTRAFLAYADNVRA
QDSAAYAIQELLSLYECKEEKNDCPGRRLWRRFPEHVQEILEPHQNTRYKSSQKAINLSN
IKKPIYLSNSGSNFAQWSATWAGYLITKIRHELASKVFSCCSIIMKHDFKVTLYLLPHIL
VYVLLGCSQEDQQEIYAEILAVFKHDDPQSRRLQDNASDLSQLSTQTVFSMLDHLTQWAR
HKFQALNADRTAGKSSRDQGELNVSELASWKKFTYCFAKLYAAMHEPDGVTGVNAIRTGE
PSLKEQILEHESTGLLRDATACYDRAMQLEPDQIIHYHGVMKSMMGLGQLSTVMTQVNGV
LANRPEWTPELNTYRVEAAWKLTQWDLLQDYLASDEKSSTWSVRLGQLLLSAKLRDTEAF
YEKLKVVRTEQIVPLSVASFERGSYQRGYEHIVRLHMLCELEHNVKEFLQQHQGDLTNEF
EQPLNWQARLEMTQNSYRAKEPILALRRAMLSLNKKPDYNEMVGECWLQSARVARKAGHH
QAAYNALLNAGKSRLSELYVERAKWHWSKGDVHQALIVLQKGVELCFPADEAPTDTKNRL
IKGRAMLLVGRFMEETANFESNAIMKKYKDVTSLLPEWEDGHFYLAKYYDKLMPMVTDNK
MERQGDLIRYIVFHFGRSLQYGNQYIYQSMPRMLSLWLDYGAKAFEWEKAMRSDRVQMRT
DLANINKIIAEHTNHLAPYQFLTAFSQLISRICHSHDEVFAVLMEIIAKVFLTYPQQAMW
MMTAVSKSSYPMRVNRCKEILQKAIHLQSSLGKFVGDANRLTDKLLELCNKSMVGNSTTL
SMNVHFKMLKRLVEGPTFSEILIPLQSVMIPTLPSTAGEHPKHDPFPGHWVYIAGFDDVV
EILASLQKPKKISLKGSDGKFYTMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRREL
HIRTYAVIPLNEECGIIEWVKNTAGLRHILNKLYKERGVYMTGKELRQCMVPKTTQQVEK
LKVFREVLLPRHPAVFNEWFLRTFPDPTSWYNSRSAYCRSIAVMSMVGYILGLGDRHGEN
ILFDSQTGECVHVDFNCLFNKGETFDVPEVVPFRLTHNMVHAMGPMGTEGLFRRACEVTM
RLMRDQREPLMSVLKTFLHDPLVEWSKPVKGSSRAQVNETGEVVNEKAKTHVLDIDQRLQ
GVIKTRNKVKGLPLSIEGHVHYLIQEATDENLLCQMYLGWAPYM
NT seq 7875 nt   +upstreamnt  +downstreamnt
atgacggagcaaggcttagaaatggcttccatgatcccagctttaagggaactagagagt
gtcagtccagaagattacaatactgtggttcagaaaccaagacagattctttgccagttc
atagaccggatactgacggatgtaagcgttgttgctttggaactttcgaaaaaaagtgag
ccacaaccgacctctgtcatgctgcttgactttattcagcacatcatgaagtcctcccat
ttgatgtttgtgaatgctgtgagtggacttcagcagcaaagtggcgtggaacatagttgt
atagatttcagcaactggattataacgaggcttcttcgaattgctgcagctccaaactgc
caggctttacataagaaaatagccaatgtcattcgctctttgttttttcttttcaaaaac
aagagctcatctattctggggatcatggcaaaggaattacttggtctgtttgaagatcta
attttcttgcatgaaagacacttgcaaatgcagctcgcagaagatgtccgcatttggcca
gtaacgttaaagaggtttttagttaagagaaaagatgcaggttatttgactcccgcatct
ctacagctggcgtccatttcaaatgtggaaccactagaaataaccctattacaagttctc
tctgacattttccctacaatattttttaggcaacagaatcttattatgtggaacataggc
tgtgctttgttacaacatggaagccctaaagcgaagggcatgacaatggattttttaaca
caaacaatacatcttggtgggcctccagaacagccagcaggctacttctttacagttttt
cttgaaatcatggcttcattaaaggcaattaatacaagagaattggaaatcattgaagaa
ccattagcacaattagttaggaccatgttccctttggaggctgaggcagctggaactatt
gaacctgtctatctcaatatgctgattgagaaactcagtgatgtattggatggtgggctg
cttaattatcttaaatcaagaaagctgaaagcagcattctgcaacttgattcagtatttt
caaagatttgtgcctctgggttacgagtctgcattagtcataagaagacagcgtgttaat
gttatttgtagagcattaatcaacatgattggagttgagacgcaacaggaatatattttg
gggtccctatatgtggcactaaagagtgaggtgatggagctccttcaagagcttcagtct
caaatcgcccctcaaatcgattcttcagatactgacggtggtagcagcagcagcgatgag
gttctaagaaagagaccacgactgagtctttcaataaaacggtctagaaagccactaact
tcagcagaaacaattcctttcagaatgggtccaatggatatgactgtgaagagtaagctg
tggagtgcactgtgccaacagctgcccaaattattgtccctcctgcaagaaaaagaaccc
cagaaccaggttacaggcacttttgaggggattgcagtaatagttcaactggctgctttg
tgtactgcccattgttctcagatttctaacagcaacacagagaaaaacactacaaagcaa
ggcagtgatgataaaaccaacctgcagggtgtaaatttgttacgggtgcagctggtatgg
atctcctctgaggttattggcacagttctgaaggggagcaagaagcagctggaatgccca
gttaaagggggtgaaataagaccagtcattgacaaaatagtgaaaattattgatgctgta
ctctacctacaagttagaagaccattagatgcagatatccttaagattgtttgtgatgta
ttgtccttgccatggattcacagtctttcaaatgatcctgcttttaaagcagttgagttc
agccctgatctgattactttgagtcatcggctttcaggcagtttctcgcagcagacccag
tcccactgtgtgtacctgttatccctgcttccaaaagaagtgagtcttgaatggaggtta
gcagtgtatcggcgcacattgcagagtccaagtgaggttgttcgcactggttcaatcaaa
ggatttccaattttgctccataaccttggagcaaagtctcatggattaattcaggaaatt
ctcatagagaaactgaaagatgactctgatttggtgaggcaggagttggctagcattatt
ggttgcttagcatgtgagctctctggaacgtttgaaatgaagcttccttctactgaacca
gtccttcatcaggcagactatgatctcctctgtaactaccttactgtgaactgtgaatgt
gttccagtagctcccccaattgaagcttcggtttttactccattcttagaactacttaat
gcacaggtgttgagttcaataaaatttgcttttattgacaacatacctcacctgtgcaaa
catgtcaaagtgggaaaaggtgaccttgactcaaaggctttcactgcagttctactaaac
ctagtggaagatccaggcaaagacattagagtggccttcagtgaaaacatcaaatattta
cttgaatctattgaatctgaagatttacaaaaggagcttctggtctcaagactgaaagtg
gcctatactaatgccaaaatgtcaagaaataatgagttgaaggagacgctgattatcact
acgggggaaattggcagagcagccaaaggagaactggtggtgtttgccctccttcacctt
ttgcattgtctattgtctaagtctacatttgtggctggagcagctcgcacagagatcaca
gaattagctgcagccagatcaatgaaactgcagtctttcttcagccaatataagaaacct
atctgccagtttttggtagaatctcttcattcaagtcagatagcattaaattccccctca
ggccagagtgatgagatgcgtcagcaggaagttgcccatcgaagggaggtggctcttgac
attttgacagaaattgctcatgtgtttgatttcccagatttaaatcgtttccttactcgt
accttgcaactgttgctgccttatctagctgctaaggccagtcttacagcatccgcgcta
atccgaacaattgccaagcagctcgctgtaaaccgcagagaaatcctcatcaataacttt
aagtacatcttctcccatctggtctgttcctgctccaaggatgaacttgagtgtgcattg
cactaccttcagaatgaaaccgaaattgagctgggcagtctactgaggcaggactatcaa
gggttgcacaatgagctactactgcgcataggagagcactatcaacaggtctttaatgga
ctggctatacttgcttcctttgcatctggtgatgatccttaccaagggcccagggatatt
acagcaccagaattaatggcagattacctgcaacctagactattggggatcttggccttc
ttcaacatgcatctgttgagctccagtgtgggtgttgaagataagaagatggccttaagc
agcttggtttccttaatgaagctgatgggacctaaacatattagttcagtgagagtgaag
atgatgaccactctaagaacaggcctgagatacaaggatgactttccagagttgtgctgc
aaggcctgggactgctttgttcgctgccttgaccagccctacttgggttccctcctcagt
cacatgatagtagctttactacctctcatacatattcagcccaaggaaactgcagcaata
tttcactatctgatagttgagaacagggatgcagtacaagattttctgcatgaaatttac
tttctaccagagcatcctgaacttgaacagattcagaaagtcttgcaggattataggaag
gagacgtccaagagcactgacctacagactgaactacagctgtctatgaaagctattcag
catgagaatgtggatgtccgtgtacatgctctaactactttgaaagaaactcttcacaag
aaccaggaaatgttgattaaatatgccacagactgtgaaactgtagagccagtcatctct
catctggtaacagtgcttctgattggctgccgggatgcaaccccccaggctctactgctg
tgtggggaatgtttaggagagctaggagccattgatccaggcagattggactttacaaca
agtgacaaccagggaacaggcttcacatttgtgactggcgtggaagaccccaattttgca
tatgaattgttgatggaactgacacgagcattccttgcttatgcagacaatgttcgagct
caagattctgcagcgtatgctattcaggaacttctgtcactctatgaatgcaaagaggag
aagaatgactgtccaggccgcaggttgtggagacggtttcctgagcatgtgcaggaaata
cttgagcctcatcagaacacaagatataaaagctcacaaaaagccataaatttgtccaac
ataaagaagccaatctacctcagcaactcaggcagtaactttgcacagtggtcagctacc
tgggccggctatctgataacaaagataagacatgaactcgccagtaaggtgttcagctgc
tgcagtatcataatgaaacatgattttaaagtgacgctatatcttttgccacacatcctc
gtctacgttttattgggatgtagtcaagaagaccagcaggagatttatgcagagatcttg
gcagtttttaaacatgatgatcctcaatctagaagactgcaggataatgcttcagatctg
agccagctgagcactcagacagtgttctccatgttagaccacctaacgcagtgggctagg
cataagttccaggcacttaatgctgatagaactgcaggcaagtcaagcagagatcagggt
gaactaaatgtgagtgagttagcaagttggaagaagtttacgtactgctttgctaaattg
tatgctgccatgcatgagcctgatggtgtgactggagtgaatgctattcgtactggtgaa
ccatctctcaaagagcagattcttgaacatgagagcactggtttattgagagatgccaca
gcctgttatgacagggctatgcagctagagccagaccagattattcattaccatggtgta
atgaagtcaatgatgggccttgggcagctgtccactgtaatgacacaggttaacggcgtg
ctggctaacaggcctgaatggacacctgaactaaacacctacagagtagaggcagcctgg
aaactaacacagtgggacttgctgcaggattacctggcttcagatgaaaagtcatctaca
tggagtgtaagactgggacagttgttactctcagccaaactaagggacacagaagctttt
tacgagaagttaaaagtggttcgaacagaacagatagtacccctgtccgtagcgagcttt
gaaagaggatcctatcagcgaggatatgagcatatcgtgaggctacacatgctttgtgag
ttggaacataatgtaaaggaatttctacagcagcatcagggggaccttactaatgaattt
gagcagcctttaaattggcaggctcgtctggaaatgacccagaattcctatcgagctaaa
gaacctatcttggcactgcgtagggcaatgctcagtctcaataaaaaaccagattataat
gaaatggttggagagtgttggcttcaaagtgctcgagttgccaggaaagcagggcatcat
caagctgcatacaatgccctccttaatgcaggaaaatcccgtctttcagagctttatgtc
gagagagcaaaatggcactggtccaagggtgatgttcaccaggcccttattgttcttcag
aagggagttgagttatgttttccagcagatgaagccccaactgataccaagaacagacta
atcaaaggacgtgcaatgctactagtggggagatttatggaagaaacagccaactttgaa
agcaatgcaatcatgaaaaagtataaggatgttacttccttgttgccagagtgggaggat
ggccatttttatctggccaagtactatgataaactaatgcccatggtaacagataacaag
atggaaaggcagggagacttgattcgatacattgtttttcattttggcagatcactacag
tatgggaatcagtacatttatcagtcaatgcccagaatgctgtcactttggcttgactat
ggagcaaaggcatttgagtgggaaaaagctatgcgttctgaccgtgtacaaatgcgaact
gatcttgcaaatataaacaagataattgcagagcacacaaaccacttggctccctaccag
tttttgacagctttctcccagctgatatcccgaatttgtcactcacatgatgaagtcttt
gcagtgttgatggagattattgctaaggtatttctaacatatccacagcaggcaatgtgg
atgatgacagcagtttctaagtcctcttaccccatgcgagtgaacaggtgcaaggagatc
cttcagaaggccattcatttacaaagctccttaggaaaatttgtaggagatgcaaatcgt
ctaactgataaactactggagctttgcaacaaatcgatggttgggaacagcacaacctta
agcatgaatgttcacttcaaaatgctgaagaggctagtggaaggacccaccttcagtgaa
atacttattcctttgcagtctgtgatgataccaactcttccatcaactgcaggggagcat
cctaaacatgatccattccctgggcattgggtctacattgccggttttgatgatgtggtt
gagatccttgcttcccttcagaaaccaaagaaaatctccttaaaaggatcagatggaaaa
ttctataccatgatgtgtaaacctaaagatgaccttagaaaagactgcaggctgatggag
ttcaactctctaattaacaagtgtttacggaaggatgcagagtctcgtaggcgagaactt
cacatccgcacctacgcagttatccctctgaacgaagagtgtggtataatagagtgggtt
aagaacacagctggtttgagacacatcctaaacaaactatataaggaaagaggtgtgtac
atgacaggaaaggagcttcgccagtgcatggtgccaaagacaacacaacaggtggagaaa
ctaaaagtgttccgtgaagttcttctgccacgacaccctgctgtgtttaatgagtggttc
ctaaggacgttccctgatcctacttcatggtacaatagtagatcagcatattgtcgttcc
atcgcagtgatgtccatggttggctatatcttgggccttggtgaccgccatggagagaat
atcttatttgattctcagactggtgaatgtgttcacgtggactttaattgtctgtttaac
aagggagaaacatttgatgttccagaagtggttccttttcgtctgacccataatatggtc
catgcaatgggtcctatgggaacagaagggttgttccgcagagcctgtgaagttacaatg
aggctgatgcgtgaccaacgagaacctttaatgagtgtcttgaagacatttcttcatgat
cctctagtggagtggagtaaaccagtgaaaggtagttccagggcacaggttaatgaaact
ggagaggttgtcaatgaaaaggcaaaaacccatgtgcttgatatagaccaacgactgcag
ggagtgattaagaccagaaacaaagttaaaggtttgcctctctccattgaaggccatgtt
cactacctgattcaagaggcaacggatgagaacttgctctgccagatgtatctgggctgg
gctccatacatgtga

DBGET integrated database retrieval system