KEGG   Latimeria chalumnae (coelacanth): 102358918
Entry
102358918         CDS       T02913                                 

Gene name
MDM4
Definition
(RefSeq) MDM4, p53 regulator
  KO
K10127  protein Mdm4
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102358918 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lcm04121]
    102358918 (MDM4)
Ubiquitin system [BR:lcm04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102358918 (MDM4)
SSDB
Motif
Pfam: SWIB zf-C3HC4_3 zf-RanBP
Other DBs
NCBI-GeneID: 102358918
NCBI-ProteinID: XP_005989280
Ensembl: ENSLACG00000017268
UniProt: M3XGV2
LinkDB
Position
Un
AA seq 491 aa
MTTASTSALYPASENACRVTSEQARQVRPTLPLLKLLHASGAEGEIFTLKEVMNCLGQYI
MLKQLYDKQQQHIVYCGNDPLGELIGVQSFSVRDPSPLYDMLRRNLTSVNSIDAAQTHTV
AKDPRADTPSQESSKRNTEEEAAERKCASPTTSQRKRRSSSEDDSLPSDQCKPLSKQPKL
DVVFEEWDVAGLPWWFLGHLRSNYECKSNGSTDLHSTQEVDTAIVTDTTDDLWFLNESDV
EQVSVQGKGDPTDSPNITEDEKGDQTDEEKKKVLELSFYEEDREDFGCLSDDTDTDSTSE
DCWRCTKCKKLNSPVKRYCFRCWALRKDWYLDCPKLVHSLSTPDITANLQEDDDVGIDIP
DCRRTVSDPVVKTVEKPQSEEKPKTLSFSSLDLSKSSLSVIKNTESQEKLDASQETWIHK
DAQEPSQKSSCQELLQFCCYCQKRPRNGNIVHGRTAHLVTCFRCARMLHKSKLPCPACKC
QIQMVIKTFIA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgaccacagcttccacctctgcactatacccggcatctgagaatgcatgccgagttact
tcagaacaagccagacaggtacgaccgacactgccccttctgaagcttctacatgcctca
ggtgctgaaggggaaatctttaccttaaaggaggtgatgaattgccttggacagtacata
atgctgaagcagctctatgacaagcaacagcagcacattgtgtactgtggaaacgacccc
cttggggagttaataggagttcaaagcttctctgttagagatccaagcccattatacgac
atgctaagaaggaacctgacttctgtcaattctatagatgccgcacagactcacacagtc
gcaaaggatccaagagcagataccccaagccaagaatcgtcgaagagaaatacggaggaa
gaagctgcagaaaggaagtgtgccagtccgactacctcacagcgcaaacgcaggagctcg
agcgaagatgacagtctacccagtgaccagtgcaaacctctatccaagcagccgaaattg
gatgttgtatttgaggagtgggatgttgctggccttccgtggtggtttctcggtcacctg
cgaagcaactatgaatgcaagagcaatgggtcgactgatctgcacagtacccaggaggtg
gatactgccattgttactgacaccacagatgacctctggttcctgaacgagtctgacgtg
gaacaggtcagtgtgcagggaaaaggggatcccacagattcccccaacatcacagaggat
gagaagggagatcagacagatgaagagaagaaaaaggtattagaactttcattttatgaa
gaagaccgtgaggacttcgggtgcttaagtgatgacacagatacagatagtacctcagag
gactgttggcgatgcactaaatgtaagaagctaaactctccagtaaaacggtactgcttt
cgttgctgggcgctgcggaaggactggtatttagattgccccaaactggtacattcccta
tccacccctgatatcactgccaacctacaggaagacgacgacgtgggaattgacattcca
gactgccggagaactgtctcggaccctgttgttaagactgtagagaaaccgcaatctgag
gaaaagcctaaaactctgtcatttagctccttggacttgtccaagtcttccctttcagtt
atcaagaatacagaaagtcaggagaaactagatgcgtctcaagaaacctggatccataaa
gacgcccaggagccttcccagaagagctcatgccaagaactactgcagttctgctgctac
tgccagaaacgccccagaaatgggaacattgtccatgggaggacagcccatcttgtgact
tgcttcaggtgtgccagaatgctccacaagagcaagttaccttgtccagcttgcaagtgc
caaatccaaatggtgataaaaaccttcatagcttag

DBGET integrated database retrieval system