KEGG   Latimeria chalumnae (coelacanth): 102360306Help
Entry
102360306         CDS       T02913                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00010  Glycolysis / Gluconeogenesis
lcm00053  Ascorbate and aldarate metabolism
lcm00071  Fatty acid degradation
lcm00280  Valine, leucine and isoleucine degradation
lcm00310  Lysine degradation
lcm00330  Arginine and proline metabolism
lcm00340  Histidine metabolism
lcm00380  Tryptophan metabolism
lcm00410  beta-Alanine metabolism
lcm00561  Glycerolipid metabolism
lcm00620  Pyruvate metabolism
lcm01100  Metabolic pathways
Module
lcm_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102360306 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102360306 (ALDH2)
   00620 Pyruvate metabolism
    102360306 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102360306 (ALDH2)
   00561 Glycerolipid metabolism
    102360306 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102360306 (ALDH2)
   00310 Lysine degradation
    102360306 (ALDH2)
   00330 Arginine and proline metabolism
    102360306 (ALDH2)
   00340 Histidine metabolism
    102360306 (ALDH2)
   00380 Tryptophan metabolism
    102360306 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102360306 (ALDH2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102360306 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102360306
NCBI-ProteinID: XP_014344083
Ensembl: ENSLACG00000011798
LinkDB All DBs
Position
Un
AA seq 523 aa AA seqDB search
MLRLALGNLSKLSRFSSPVSLNRFSAAAAAIPTPNPQQEVYFNKIFINNEWHDAVSKKTL
PSINPATGEVICQVAEGDKADVDKAVKAARNAFKLGSPWRRMDASERGVLLNRLADLIER
DRTYLATLEALDNGKPYAVAYAVDLNMVVKCLRYYAGWADKCHGKTIPMDGDFFCYTRHE
PVGVCGQIIPWNFPLLMQAWKLGPALATGNVIVMKVAEQTPLTALYVANLIKEAGFPPGV
VNIIPGFGPTAGAAIASHMDVDKVAFTGSTEVGHLIQKAAGGSNLKRITLELGGKSPNII
MSDADMDYAVEQAHFALFFNQGQCCCAGSRTYVQDSIYDEFLERSVERAKARVVGNPFDL
NTEQGPQIDEEQFQKILGYISTGKREGAKLLCGGGVAADRGYFIQPTVFGDVKDDMTIAR
EEIFGPVMQVLKFKSIEEVIERANDTQYGLAAAVFTRDLDKANYVSQGLRAGTVWINCYD
VFGAQSPFGGYKTSGNGRELGEYGLEAYTEVKTVTIKVPQKNS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgacttgcgctcggaaatttgtcgaaactctcccggttttcttctccggtttct
ctaaaccgattctcggccgcagctgctgcaatcccgacccccaacccccagcaagaagtc
tatttcaataagatttttataaacaatgagtggcatgatgcagttagcaagaaaacattg
ccttcaatcaatccagccacaggagaagttatctgtcaagttgcagagggagacaaggct
gatgtagataaagcagtaaaggcagcacgaaatgcctttaaactaggatcaccatggaga
cgaatggatgcctctgaaaggggtgtgctgctaaaccgcttagctgacctgattgagcga
gacagaacttacttggctacgttagaagcgctggacaatgggaagccgtacgcggtagct
tatgcagtggacctgaatatggtagtcaaatgcctccgatactatgcaggatgggctgac
aaatgtcatggaaagaccattcccatggatggtgactttttttgctatactcgacatgag
ccagttggagtctgtggacagattattccatggaatttcccactgctgatgcaggcatgg
aagcttggaccagccctggcaactgggaatgtgatagtgatgaaagtggctgaacaaact
cccttaactgcgctttatgtggccaatctcattaaagaggcgggatttccaccaggtgta
gtcaacattattcctggtttcgggccaactgctggtgctgccattgcttcacacatggat
gtagacaaggttgctttcacaggatccacagaggttggtcatctgatccagaaggcagct
ggaggcagtaatttgaagcgaataacgcttgaacttggcggaaagagtccaaatatcata
atgtcagatgcagacatggactatgcagtagagcaggcccattttgccctgttttttaac
caagggcaatgttgttgtgctggatcccgtacttatgtccaagactccatctacgatgag
tttttggagagaagtgtagaaagagctaaggccagagttgttggaaacccatttgatcta
aacaccgagcaaggacctcagattgatgaggagcaattccaaaagatccttggttacatc
agtactggaaaacgtgaaggagctaagctgctttgtggaggaggtgttgctgcagaccga
ggttacttcattcagccaactgtgtttggtgatgtaaaggatgacatgactatcgctagg
gaagagatttttggaccagttatgcaagtcctgaaattcaaatcaattgaggaagtaatt
gaaagagcaaatgatactcagtatggtttggctgcagctgttttcacaagagaccttgat
aaggctaactatgtgtcccagggactgcgagctggaacagtttggataaactgctatgat
gtatttggagctcagtccccatttggtgggtacaaaacgtcaggaaatggtagagaattg
ggcgaatatggtcttgaggcctatactgaagtaaagacagtaacgatcaaggttcctcag
aagaactcttaa

DBGET integrated database retrieval system