KEGG   Larimichthys crocea (large yellow croaker): 104920259Help
Entry
104920259         CDS       T04659                                 

Gene name
iqca1
Definition
(RefSeq) dynein regulatory complex protein 11
Organism
lco  Larimichthys crocea (large yellow croaker)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA IQ AAA_5 NACHT
Motif
Other DBs
NCBI-GeneID: 104920259
NCBI-ProteinID: XP_027145706
LinkDB All DBs
Position
XVII
AA seq 825 aa AA seqDB search
MSQRTYNQMWADVQLELSRLLTEELPAEPPRPEKDRVVFFQRLAMLFVRYVQIFRKLEEV
YDQVVHPQKRQLIRTVLDGVIGRVLELKNEMVEKEFSEYHYMDDVLQDLKLKPVDLEIPI
PRYFISDCSKALQQRKMMVADILKMVAATESLSPLMAKDMSQEEAIKIIQVAERARQGRL
RAKLNEESRKMNRMYTTKEPGTGGIESAAICIQKVWRGYIQRKRTKIARIEEMIFLGMIM
DPKYQAPCPAEISARANEAYTRTKQEEYEEDYQKSVVAITNQLQDVEGQDMCMTMKDQIR
QWFIECRDATGSFPDYPDEEEGGSALIFSEKDPQQLMEEIAAKEEEDSNNKPKGKEEKKE
KGKKDKGKGDEEEEEAGLKMLPSAFLPDLEVGHKTYVDFWQNRNETKNFNQRHEVELIKE
EKRKVIEAQIRLQVDEQMRQELAEWKLAVDKDKGGKTKGNPKKKKGSKSGKKKKKEKDLT
SDRTLESLCQELVEQGLLKQANNVRMQDYLGDYSYLGTTLRQNDIEPMPSLSDVRQVLSL
YAVLPLGSQEVHEKAPLIKAILLVGPAGVGKKMLVHAICQETGANLFDLSPLNTAGKYPG
KSGLAMMLHMVLKVARLLQPSVIWIEDAEKMFYKKVPKEEKELEPKRLKKDLPKSLKLIK
GEDRVLIIGTTKDPLSADIKSLCKMYSKIILIPRPDYGSRHILWKQLIKNQGGEITKALD
LSSLAKISDGYTPGHIVQVIQSVITKRRILQQANRPLTAAEFVVPLAKIDPVFQEEEESL
KNWYAKTPLGKKRIKAATGKEEEEGGAPVKDKGKKDKNAKKKGKK
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagaacatacaaccagatgtgggcagacgtccagttagagttgagccgtttg
ctgactgaggagcttcctgccgagccccctcgcccagaaaaggacagggtggtgttcttc
cagcgtcttgccatgctttttgtgcgctacgtccaaatatttagaaagctggaggaggtg
tatgatcaggtggtccaccctcagaagagacaacttattcggacagttcttgatggtgtg
atcgggagggtgttagagctgaagaatgaaatggtggaaaaggagttttcagagtaccac
tacatggatgacgtccttcaagacttgaagcttaaacctgtagaccttgagatccctatc
cctcgatatttcatcagtgattgcagcaaagcactccaacaacgaaagatgatggtggca
gatatcctcaaaatggtggcggctactgaaagcctaagtcctctaatggccaaggacatg
agtcaagaagaggccataaagatcattcaagtggcggagagagcgcgccaaggacgcctg
agggcaaagttgaatgaagagagccggaaaatgaacaggatgtacacgaccaaagaacct
ggaacaggtggcattgagtcagctgcaatctgcattcagaaggtgtggaggggctacata
cagaggaagaggacaaagattgctcggatagaagagatgatttttttgggaatgatcatg
gatccaaaataccaggcaccgtgccctgcagaaatctctgctcgggccaatgaagcttac
acacggactaaacaggaagagtatgaggaagactatcagaagtctgtcgtggctatcaca
aaccaactgcaggatgtggagggtcaagacatgtgcatgaccatgaaagaccagatccga
cagtggttcattgaatgtcgtgatgctacgggatcgttcccagactacccggatgaagag
gagggaggctcagccctcattttttctgaaaaggaccctcagcaattaatggaagaaatt
gctgcaaaggaagaggaggactccaacaacaaaccaaaagggaaggaggagaagaaagaa
aaagggaaaaaggacaaagggaagggtgatgaagaagaagaggaggcaggattaaagatg
ctaccttcggcttttcttccagacttagaagtgggacacaaaacctatgtagatttttgg
caaaaccgcaatgagaccaaaaacttcaaccagaggcatgaggtggagctgatcaaggaa
gaaaagaggaaagtcattgaggcacagattcgactacaggtagatgagcagatgagacaa
gagctagccgaatggaagctagctgtggataaagacaagggcggtaaaaccaaaggaaat
cccaagaaaaagaaaggatctaaaagtggaaagaagaaaaaaaaggagaaagatttgacg
tctgacaggactcttgagtccctgtgtcaggagctggtggaacaaggcttgttgaaacag
gcaaataatgttaggatgcaggattacttgggggactatagctaccttgggaccacactg
agacaaaatgacattgagcccatgccatcattgtcagatgtgcggcaggtcttatctctg
tatgcagttctaccattaggctctcaggaggtacacgagaaggcacctctcattaaggcc
atcctactggtagggccggctggtgtaggtaagaagatgttggtccatgcaatctgccag
gagaccggtgccaacctctttgatctgtcacctctgaacacagcaggaaagtacccaggc
aagagtggcctcgcaatgatgcttcacatggtgttaaaggttgcaagattgctgcagcct
tctgtaatatggattgaagatgcagaaaaaatgttctacaagaaagttcccaaggaagaa
aaagagttagaaccaaaacgtctgaagaaagacttgcccaagtctctcaagctgatcaaa
ggggaggatcgtgttctgataataggaacaactaaagacccactaagtgctgatatcaag
tcactgtgtaaaatgtacagcaaaatcatccttatcccaagacctgactatggctcaaga
cacatcttgtggaagcaactgatcaaaaatcaaggaggtgagataactaaggcgctggac
ctcagctctcttgcgaagatttctgatggctacacacccggtcacattgtccaagtgatc
cagagtgttatcaccaagcgtcgcatcctacagcaggcaaacagaccactcactgctgct
gagtttgtcgttccattagccaagattgaccccgtgtttcaggaagaagaagagtctctt
aaaaactggtatgcaaagacaccccttgggaagaagagaattaaagctgccacaggaaag
gaagaagaagaagggggggcgccagttaaagataaaggcaaaaaagacaaaaatgcaaag
aagaaagggaaaaaataa

DBGET integrated database retrieval system