KEGG   Larimichthys crocea (large yellow croaker): 104927792Help
Entry
104927792         CDS       T04659                                 

Gene name
galnt17
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00512  Mucin type O-glycan biosynthesis
lco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    104927792 (galnt17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lco01003]
    104927792 (galnt17)
Enzymes [BR:lco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     104927792 (galnt17)
Glycosyltransferases [BR:lco01003]
 O-Glycan biosynthesis
  Mucin-type
   104927792 (galnt17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 104927792
NCBI-ProteinID: XP_010740256
LinkDB All DBs
Position
VII
AA seq 599 aa AA seqDB search
MAFVFRRWRVLLVLNVLAVAGFMTYWTKCNTRSVQAAGLDAPADGKRPRGNGTAQGPSVS
HEVLLKRLSSLEDVVYRQLNGLSKSLGLIEGFGGRGKGGLPATLSPSEESDAKYLREKYG
YNAYLSDRISLDRTIPDHRPGKCRKVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHT
PAHLLKEIILVDDNSDDEQLKGPLEEYVNKRYPGLVKIVRNQKREGLIRARVEGWKVATG
EVAGFFDAHVEFTPSWAEPVLARIKEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWEL
WCMYISPPKQWWDEGDISAPIRTPAMIGCSFVANRHYFGELGLLDSGMDVYGGENIELGI
RVWLCGGSMEVLPCSRVAHIARTKKPYHSNIAFHTRRNALRVAEVWMDEYKSNVYLAWNI
PMENHGIDYGDVSPRVALRKKLQCKSFEWYLDNVYPEMRRYNNTLFYGEIRNSKASHLCM
DQGMKENHTATLHPCHGWGPQLGRYTKEGQLFLGALGSTGEDTHCVVDDQVSNLPQMLNC
DKISNVKQKTWHFSQNASIINRASGRCLEVVPAKVYFGHLLVLQPCSGQRWNIKNTMKP
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtgttcaggagatggagggttttactggtgctgaacgtgctcgccgtcgct
ggcttcatgacttactggaccaagtgcaacacgcgcagcgtccaagccgccggtctggat
gctccggctgacgggaagaggccccggggcaacgggacggcgcaggggcccagcgtcagc
catgaggtgctgctgaagaggctgagctcgctggaggacgtggtgtacaggcagttgaac
ggtctatctaaatctctgggtctgattgagggcttcgggggtcggggtaaaggcggcctc
cctgccacgctgtcaccatctgaggagagcgacgccaaatacctgagggagaagtacggc
tacaacgcctacctcagcgacagaatctctctggatcggaccataccggaccaccggcct
ggcaaatgcagaaaggtcagctacccgagagacctcccccagatctccctcatcttcatc
tttgtcaacgaggctctgtcggtgatcctgcgctcagtccactcggctgtcaatcacacg
ccggctcacttgctcaaagaaatcatcctggtggacgacaacagcgatgacgagcagctg
aaaggtccgctggaggagtacgtgaacaagcgctaccccggcctggtgaagatcgtcagg
aaccagaagagagagggactgatccgagccagagtcgagggctggaaggtggccaccggc
gaggtggcgggcttctttgacgcccacgtggagttcaccccgtcctgggccgagccggtt
ctggccagaataaaagaggaccacaagaggatcattctgccctccatcgataacatcaag
cacgacacgttcgaggtggagcgctacgagaactcgggccatggctacaactgggagctg
tggtgcatgtacatcagcccgcccaaacagtggtgggacgagggcgacatatctgctccc
atcaggactcccgccatgatcggctgctccttcgtggccaaccgtcattactttggcgaa
ctcggcctgctcgactcgggcatggacgtctacggaggggagaatatcgaactgggcatc
agggtgtggctgtgtggaggcagtatggaggtgctgccttgttccagggtggctcacatc
gctcggacgaagaaaccctaccacagtaacatagctttccacacgcggcgtaacgctcta
cgagtggctgaggtctggatggacgagtacaagtccaacgtctacctggcctggaacatc
cccatggagaaccacggtattgattacggagacgtctctccgagggttgcgctgaggaag
aaactgcagtgtaaaagctttgagtggtacctcgacaatgtttacccagagatgaggagg
tacaacaacaccctgttctacggagagattcgtaactccaaagcgagccacctgtgtatg
gatcagggtatgaaggagaaccacacggccaccctgcacccctgccatggatggggtcct
cagttgggacgttacaccaaagagggtcagctgttcctgggcgctctgggcagcaccggc
gaggacactcactgcgtggtggacgatcaggtcagcaacctccctcagatgctcaactgt
gacaagatcagcaacgtgaagcagaagacgtggcacttctcccagaatgcttcgatcata
aaccgagcctcgggacgctgtctggaggtcgtgccagctaaggtttactttggccacctg
ctggtcctgcagccctgctccgggcagaggtggaacatcaagaacaccatgaagccgtag

DBGET integrated database retrieval system