KEGG   Larimichthys crocea (large yellow croaker): 104931327
Entry
104931327         CDS       T04659                                 

Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04010  MAPK signaling pathway
lco04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104931327
   04012 ErbB signaling pathway
    104931327
SSDB
Motif
Pfam: 7tm_7 EGF Laminin_EGF
Other DBs
NCBI-GeneID: 104931327
NCBI-ProteinID: XP_019117992
LinkDB
Position
VI
AA seq 261 aa
MMTRIFWDAIFLISGTFSMSVVLNGSLFTFGAGPSNSTIIEASISIDTNSTAISNISTSG
SVTTSSRNTTTTTTVTTTTDAPPVKDSLFTLETETSDSTMNESIIFIETNFTAASNTSTS
NSALTTTTTATSTTNIPPVKKFVAAAVRSHFDDCPDSHRHFCFHGSCRFLILEETPACVC
HPGFVGMRCEHADLLAVVATNHRQQTVATVLVLCVIGCVLIMVLCTLLHCWWRQDCRRRR
LAHHYVLEKHGAPCYPSESVV
NT seq 786 nt   +upstreamnt  +downstreamnt
atgatgactcggattttctgggatgcaatttttctcataagcggtacttttagtatgtct
gtggtactcaatggttccctctttacatttggagcagggccgagcaattcaacaattatt
gaagccagcatttccatcgatacaaattccaccgccatttcgaacatctcgacaagtggc
tctgtaacaaccagcagcagaaacacaactaccacaaccaccgtgactacaacaacagat
gcccctccagttaaagattctctctttacattagaaacagagacgagcgattcaacgatg
aatgaatcaataattttcatcgaaacaaacttcactgcagcttcaaatacatcgacaagc
aactctgcgttaacgaccacaactactgcaacttctacaactaacatccctccagttaaa
aagtttgtggcggcagctgttcggtctcattttgatgactgtccagactcccatcgccat
ttctgcttccatggctcctgtcgcttcctgatattagaggagacacctgcatgtgtgtgt
catcccggctttgttgggatgcggtgtgaacatgcagatctactcgctgtcgttgcaacg
aatcacagacaacagacagttgccacggtgctggtgttgtgcgtgattgggtgtgttctc
atcatggtgttatgtacactgttacactgctggtggaggcaggactgtcgccgacggaga
ctcgcgcatcactacgtcctagagaagcatggagcgccttgctatccttctgagagtgtg
gtttga

DBGET integrated database retrieval system