KEGG   Larimichthys crocea (large yellow croaker): 104939589
Entry
104939589         CDS       T04659                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco04068  FoxO signaling pathway
lco04110  Cell cycle
lco04115  p53 signaling pathway
lco04218  Cellular senescence
lco04310  Wnt signaling pathway
lco04340  Hedgehog signaling pathway
lco04371  Apelin signaling pathway
lco04510  Focal adhesion
lco04530  Tight junction
Brite
KEGG Orthology (KO) [BR:lco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104939589
   04340 Hedgehog signaling pathway
    104939589
   04371 Apelin signaling pathway
    104939589
   04068 FoxO signaling pathway
    104939589
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104939589
   04115 p53 signaling pathway
    104939589
   04218 Cellular senescence
    104939589
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104939589
   04530 Tight junction
    104939589
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104939589
NCBI-ProteinID: XP_019121253
UniProt: A0A0F8AMV6
LinkDB
Position
X
AA seq 421 aa
MIKQSSSSSSGQLVVNVPHSVGDTLRFLLNVCRVKQKKESERTKRGLTLFTHYTLLLFPP
VTEAASYSLTSSQKVGTLLSATCGADLRLLLEAKSKPVLLFASTVARRKPLKQTSVSVHG
RGRSMEPQLLCCEGDRPAIRRAYRDSNLLTDRVLHTLLRAEDKYLPAPNYFKCVQREVVP
YMRRIVATWMLEVCEEQKCEEEVFLLAMNYMDRFLSVEHTKKSHLQLLGATCMFLASKLK
ETIPLTAEKLCIYTDNSVAPSQLLQMELLVLNKLKWDLASVTPLDFIDHFLSQLPVRTEN
RSILRKHAQTFVALCATDVKFIASPPSMVAAGSMVAAVEGLQMRMVGNAMMSQKLTEQLA
QTIRSDPDCLRACQEQIESLLETSLRQAQQPNNSVTIEETKNISDGQDLSTTPTDVRDVN
I
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgataaaacagagcagcagcagcagcagcgggcagctggtcgtcaatgtgcctcacagt
gtcggtgacacactccggtttctcctgaacgtctgtcgtgtgaaacaaaagaaagaaagt
gagaggaccaaacgaggactcactctgttcactcactacactctactgctcttcccaccg
gtgactgaagcggcttcgtactctctcacaagttcacagaaagttggaacgcttttgtct
gcaacatgtggagccgaccttcgtttgttgttagaagctaagtccaagcctgttttactg
ttcgccagcaccgtcgcacgaagaaaacccctgaaacagacatcggtcagtgttcacggc
agaggaaggtcaatggaacctcagctgctgtgctgtgagggagacaggcctgccatccgg
agggcctaccgggactccaacctactgactgaccgggtcctgcacactctgctacgcgca
gaggacaagtacctcccggctccaaactacttcaaatgcgtccagagagaagtggttccg
tacatgaggaggatagtggctacctggatgttggaggtgtgtgaggagcagaagtgtgag
gaggaagtgttcctcctggctatgaactacatggaccggttcttgtcagtagaacacacc
aagaagagccatctgcagttactgggggctacatgtatgttcctggcatccaaacttaag
gagacaatcccactcactgctgagaaactctgcatctacacagataactctgtagcacca
tctcaactgctgcaaatggagcttctggtcttgaacaaactgaagtgggacctggcttca
gtcacccctctggacttcattgaccacttcctgtctcagctgcctgtcaggacagagaac
aggtccatactcaggaagcatgcacagacgtttgtagcactgtgtgccactgatgttaaa
ttcatagccagccctccgtccatggtagcagcaggcagtatggtggctgcagtggagggc
ttacagatgagaatggtcggcaatgccatgatgtctcagaaactgactgagcagctagca
cagaccatcaggagtgacccggactgtctcagggcttgtcaggaacaaatcgagtctttg
ctggaaaccagtctcagacaggcacaacaacccaacaactctgttaccatagaagaaact
aagaacatcagtgacgggcaggacctctctactacgcccacagatgtcagggacgtaaac
atctga

DBGET integrated database retrieval system