Leclercia sp. W17: DVA44_20705 Help Entry DVA44_20705       CDS       T05987                                  Name (GenBank) DNA polymerase III subunit psi   KO K02344   DNA polymerase III subunit psi [EC:2.7.7.7] Organism lee  Leclercia sp. W17 Pathway lee03030   DNA replication lee03430   Mismatch repair lee03440   Homologous recombination Brite KEGG Orthology (KO) [BR:lee00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     DVA44_20705    03430 Mismatch repair     DVA44_20705    03440 Homologous recombination     DVA44_20705  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lee03032]     DVA44_20705    03400 DNA repair and recombination proteins [BR:lee03400]     DVA44_20705 Enzymes [BR:lee01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      DVA44_20705 DNA replication proteins [BR:lee03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      DVA44_20705 DNA repair and recombination proteins [BR:lee03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      DVA44_20705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_III_psi CSTF_C Motif Other DBs NCBI-ProteinID:  AXF66344 UniProt:  A0A345CEY9 LinkDB All DBs Position complement(4171343..4171756) Genome browser AA seq 137 aa AA seqDB search MASRRDRQLQQLGITQWGLRRPAALQGEIAISLPAHIRLVMVAQSLPALSEPVIADVLRA LRLSADQVLQLTPDRVAMLPEGSRCNSWQLGVREEIALEGASMASPALDELNVNPAARRA LWQQICEHEHNFFPHDN NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggcatcccgacgagacaggcaattacagcagctgggcatcacccagtgggggctgcgc cgcccggcggccttgcagggcgaaatcgctatctcgctaccggcgcatattcgtctggtg atggtggcccaaagcctgcccgccctcagcgagccggtgatcgccgacgtactgcgggcg ctgaggctgagtgccgatcaggtgctgcaactgacgcccgatcgcgtggccatgctgccc gagggcagccgctgcaacagctggcagcttggcgtaagagaagagattgctctggagggg gcgagtatggcctctccggcgctggacgaacttaacgtaaacccggcggcacgtcgcgcg ctgtggcaacaaatctgcgaacatgaacacaatttcttccctcacgacaactga

DBGET integrated database retrieval system