Legionella fallonii: LFA_3269 Help Entry LFA_3269          CDS       T03771                                  Name (GenBank) Protein MbtH (modular protein)   KO K05375   MbtH protein Organism lfa  Legionella fallonii Pathway lfa00261   Monobactam biosynthesis lfa01100   Metabolic pathways lfa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lfa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LFA_3269  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:lfa01008]     LFA_3269 Polyketide biosynthesis proteins [BR:lfa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LFA_3269 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CEG58605 UniProt:  A0A098GAU3 LinkDB All DBs Position I:3587270..3587518 Genome browser AA seq 82 aa AA seqDB search MYKFQSIMPDQTPENGKTYNVVINEEEQYSIWPTTKDLPNGWQKVGVQGLRDDCLSHIKE VWTDMRPLSLRSRMAVTSESEN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtataaatttcaatcaattatgccggatcagacccctgaaaatggaaaaacttataat gtggtcatcaatgaagaagagcaatattcaatatggccgaccactaaagacctaccaaat ggatggcaaaaagtaggcgttcaaggtttgagagatgattgcttatcgcatatcaaagaa gtatggacagacatgcgccccttatctctcaggagtagaatggcagtaacatcggaatct gaaaattga

DBGET integrated database retrieval system