KEGG   Leuconostoc garlicum: A9176_04230Help
Entry
A9176_04230       CDS       T04802                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lgc  Leuconostoc garlicum
Pathway
lgc00620  Pyruvate metabolism
lgc00680  Methane metabolism
lgc01100  Metabolic pathways
lgc01120  Microbial metabolism in diverse environments
lgc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lgc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9176_04230
  Energy metabolism
   00680 Methane metabolism
    A9176_04230
Enzymes [BR:lgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9176_04230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: AQN79605
LinkDB All DBs
Position
complement(821291..822808)
Genome map
AA seq 505 aa AA seqDB search
MTQRKIPTIMGTQHPDNANAPFWDASQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKDQQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFEQRPLFEAILPMAQRADQLLKMQVLFEKLANFKSVEFTRSDKNTPYIEIIPLFEDFDT
QLHAPEILKDYLKLHEEHFGFRPKYMRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAR
EENIEIYPISGTGSAIFRGGLSPHRIDRYVKEFPGVRTATVQSAFRYDFPIADVQQAIAE
LKEKLPTAEPLKISAADQKILAEVAEESAEFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGAFYSIGVPPEFIGFGRTLENLNADHLSAFVRNYPSMKD
DFRELARFVNLDALAILKTQSPAWADVERDIMIVKDIFDLEIGPKTREEQQHAEIALQVV
QIKEGAPIAITALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgaaaaatccctacgattatgggtacgcaacaccccgataatgcgaatgca
cctttctgggatgcatcccaacaaccttttatcagcgcctatcgcgaaatgaacgaagct
tttgaaaatttcagtgaattaaatgttgatgaatacatgtgggattgggaaggtaagcac
gccgatgctgccgtcattgatcgcctatttagcaccgaatatgattactttaaagaccaa
caaattggtcgtgataaattcttgacgttccgcttcccaaacatttgggaagaaaaaggc
tataacttgatgcaagcgatgactgccattttaagttcagaagatttcgcgcatgattta
ggctttgaacaacggccactatttgaagccattttgccaatggcacaacgcgctgatcag
ttgctaaagatgcaagttttgtttgaaaagctagccaactttaagtcagttgagtttacc
cgttcagataaaaacaccccttatattgaaattattcccctatttgaggattttgacacc
caacttcacgcaccagaaattttgaaagactacctcaagttgcatgaagaacattttgga
ttccgaccaaagtatatgcgtgttttcctggctggatctgattcagcgttgacagctggc
ttcatgagctcaattacgggtaacaagttagccattgcgcgcttacatgaatttgcccgt
gaagaaaacattgaaatttatccaatttcagggactggttcagcgattttccgtggtggc
ttgtcaccacaccgtattgatcgttacgtcaaagaattccctggtgttcgtacggcaaca
gttcagtctgctttccgctatgatttcccaattgctgatgtccaacaagcgattgccgaa
ctaaaggaaaagttaccaaccgctgaaccattaaagatttcagctgctgaccaaaagatc
ttagccgaagtcgctgaagaatcagctgaattttatgcgcacacactagaccaattggtg
cctgatatgcaaccgattttcaaggccttcccaaagcgtcgtgaccgtcgccaacacgtt
ggtgtcttaggttactcacgttctgttgacggtattgaattaccacgtgccatcaacttc
accggtgccttttattcaatcggtgtgccaccagaattcatcggctttggccgtaccctt
gaaaacttaaatgctgatcatctgtcagcgtttgtccggaattacccaagtatgaaggat
gacttccgtgaactcgcccgctttgtcaatctcgatgcactcgcaatcttgaagacacaa
agtcctgcttgggctgatgttgaacgcgacattatgattgtcaaagatattttcgacctt
gaaattggtcctaaaacccgtgaagaacaacagcatgccgaaatcgctttgcaagttgtg
caaattaaagaaggtgcgccaattgccattacggctttaattaaccgcatggcgcagctc
cgccacttcttaggataa

DBGET integrated database retrieval system