KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_189014Help
Entry
LOTGIDRAFT_189014 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi04068  FoxO signaling pathway
lgi04144  Endocytosis
lgi04350  TGF-beta signaling pathway
lgi04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    LOTGIDRAFT_189014
   04068 FoxO signaling pathway
    LOTGIDRAFT_189014
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    LOTGIDRAFT_189014
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    LOTGIDRAFT_189014
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 20244825
NCBI-ProteinID: XP_009054328
JGI: 189014
UniProt: V4AK79
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MEKLSPFTPPIVKRLLGLKKGEHDRDDKWSEKAVKSLVKKLQKTGGLDELTKALSTQDIN
TSCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHQELRAVDKCDYAFHLKRDEVC
VNPYHYIRVVPPGRSVVLVPRHTEIPDKIPQLDDYSTTIPENIDCKVGINENFSIPDSPP
PGYMSEEGDTSDTQGMGEFILSPLNAILINLDLDPVNSSDNDLQPVTYKEPDFWCSIAYY
ELNTRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRTQQVEMTRRYIGKGVRLYY
IGGEVFAECLSENAVFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQ
GFESVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPSWIEIHLNGPLQWLDRVLTQMGSPG
LPCSSMS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctgtcccctttcacacctccaattgtgaagcgacttttagggttaaaaaaa
ggagaacatgacagagatgataaatggtcagaaaaagctgtcaaaagtttagtgaaaaag
ttacagaaaactggaggcctagatgagttaactaaggcattgtcaacacaagacatcaac
actagttgtattacaataccaagatctttggatggtcgtttacaagtttctcatcgtaaa
ggtttaccccatgtaatttattgtcgtttatggagatggccagatttacagagtcatcaa
gaactacgagctgtagataaatgtgactatgcctttcatttaaaacgggatgaagtttgt
gtgaatccttatcactatatcagagttgtaccaccaggtaggtctgttgtattagtacca
cgtcatacagaaatacctgataaaattcctcaacttgatgattattcaacaacaatacca
gaaaatattgactgtaaagtcggcatcaatgaaaacttcagcataccagatagcccacct
ccaggctacatgagcgaagaaggagacacttctgatacgcaaggaatgggtgagtttatt
ctgtcgccattaaatgcaattttgataaatctagatctagatcctgtaaacagctctgat
aatgatttacaaccagttacatataaagaaccagatttctggtgttctattgcctattat
gagttaaatactagagttggagaaacttttcatgcttcacaaccctcactaacagttgat
ggtttcactgacccttccaactcagagagattttgtttaggactgctgtctaatgttaat
cgaactcaacaagttgaaatgaccagacgttatattggtaaaggtgttagattgtattat
attggtggtgaagtatttgctgaatgtttaagtgaaaatgctgtatttgtacagagtcct
aattgtaatcaaagatatggttggcatccggctacagtttgtaaaataccaccaggttgt
aatttaaagatatttaataatcaggaatttgctgcactattagcccagtcagttaatcag
ggttttgaatcagtttatcaacttaccagaatgtgtactattagaatgagttttgttaag
ggttggggagctgaatatagacgacagacagtaactagtacaccaagttggatagaaata
catttaaacggtccattgcaatggttagatcgtgttttaactcagatgggttctcctggt
ttaccatgttccagtatgtcttaa

DBGET integrated database retrieval system