KEGG   Listeria grayi: NCTC10812_00158Help
Entry
NCTC10812_00158   CDS       T06340                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lgz  Listeria grayi
Brite
KEGG Orthology (KO) [BR:lgz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC10812_00158 (ahpF)
Enzymes [BR:lgz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC10812_00158 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_3 FAD_binding_2 Thi4 HI0933_like DAO AlaDh_PNT_C NAD_binding_8 Glutaredoxin Thioredoxin_4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: VEI30701
UniProt: A0A3S4WSQ6
LinkDB All DBs
Position
1:155944..157473
Genome map
AA seq 509 aa AA seqDB search
MLDADIKAQLAQYLELLENPIVLKPSVGEDENSQKLLQFVEEIAAMSTKITVEAGTSEKV
PSFSVDRPEEATGIVFAGIPLGHEFTSLVLALLQVSGRAPKIDESVKSQIEAISVPYHFD
SYISLTCHNCPDVVQALNIMSVLNPNISHTMTDGSMFKAEVEAKGIMAVPTVYVNGESFT
SGRTTIEEILTKLGSAAPVENLSEKEPYDVLIVGGGPAGASAAIYAARKGIRTGMVVDNF
GGQVMDTLGIENLIGTRYTEGPKLMASVEEHVNAYDVDIMKSQRSAKLEKKELVEVTLES
GAVLKSKTAIVSTGASWRKIGVPGETEFKNKGVAYCPHCDGPLFADKDVAVIGGGNSGIE
AAIDLAGIVKHVTVLEFLPELKADRVLQERLHSLPNVTVLTNVQTKEITGENTVNGITYS
DRETGTEVHLDVQGVFILIGLMPNTAWLDGTVERNKMGEILTDKQGATNIPGVFAAGDCT
DAAYKQIIISMGSGATAALGAFDYLIRNY
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcagatataaaggcgcaattagcgcaataccttgaattgttagaaaacccg
atcgttctgaaaccaagtgtcggcgaagatgaaaactctcaaaaactacttcaattcgtg
gaagaaatcgcagcaatgtcgaccaagatcacagtcgaagcgggtacttctgaaaaagtc
cctagttttagcgtagatcgcccagaggaggcaacgggtattgtctttgccggtattccg
ctaggccatgaatttacttcgcttgtactggctttattacaggtaagcggccgggcacca
aagatcgacgaaagtgtgaaaagtcagatcgaagcaatcagtgtgccttatcacttcgat
tcttatatcagcttgacgtgccataattgcccggacgtcgtgcaagcgctgaatatcatg
agtgtactgaacccaaatatctcccacacgatgacagacggttcgatgttcaaagcagaa
gtagaagcaaaagggatcatggctgtaccaactgtctatgtcaacggtgaatcttttacc
agcggccggacgacgattgaagagatccttacaaaattaggcagcgcagcccctgtggaa
aacctttccgaaaaagaaccttacgacgttttgatcgtgggtggcggccctgccggagcg
agtgcggcgatctatgcagctcgtaaaggtattcgaacgggtatggtagttgacaatttt
ggcggtcaagtgatggatacattaggtattgaaaatttgatcggcacgaggtataccgaa
ggacctaagttgatggcttctgtggaagagcatgtaaacgcctatgatgtcgatatcatg
aagtcgcaacgctctgctaaactggagaaaaaagagttggtcgaagtgacgctggaaagc
ggagccgttcttaaaagtaagacggcgatcgtgtccactggcgcaagttggcgcaaaatc
ggcgttcccggcgaaacggaatttaagaataaaggtgtggcttactgcccgcattgcgat
gggccgctgtttgctgacaaagatgtagctgttattggcggcggtaactcaggaatcgag
gcagcgatcgatcttgcgggtatcgtcaaacacgtcacagtgttggaatttctaccggaa
ctaaaagcagatagagtgttgcaagaacggctgcattctctgccaaatgttactgtttta
acaaatgtccaaacaaaagaaatcactggtgaaaatacagtgaatgggattacttacagc
gaccgtgaaactggaacggaagtccatctggatgttcaaggtgtctttatactgattggt
cttatgccgaacacagcctggctggacggaaccgtagaacgcaataaaatgggtgagatc
ttgaccgacaagcaaggggcaaccaatattccaggcgtgtttgctgcaggagactgcaca
gatgctgcctataaacagatcattatctcaatgggctctggagccactgcggcattagga
gcatttgactatttgatcagaaattattaa

DBGET integrated database retrieval system