Lactobacillus helveticus DPC 4571: lhv_0471 Help Entry lhv_0471          CDS       T00625                                  Name (GenBank) Preprotein translocase   KO K03075   preprotein translocase subunit SecG Organism lhe  Lactobacillus helveticus DPC 4571 Pathway lhe02024   Quorum sensing lhe03060   Protein export lhe03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:lhe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     lhv_0471  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     lhv_0471  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     lhv_0471  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:lhe02044]     lhv_0471 Secretion system [BR:lhe02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    lhv_0471 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG FtsK_4TM Motif Other DBs NCBI-ProteinID:  ABX26678 UniProt:  A8YTT7 LinkDB All DBs Position 464502..464720 Genome browser AA seq 72 aa AA seqDB search MTLLIIVSILIVIATMMQPQKQQDALNALSGGAVFSGQTKKRGFEAFMEKVTAVLLVLFF VFAIILAYMSTK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacgctactaatcattgtttcaatcttgatcgttattgcaacaatgatgcagccacaa aaacaacaagatgcattgaacgccttatctggcggtgccgtttttagtggtcaaaccaaa aaacgtggttttgaggcatttatggaaaaagtaaccgcagttttattggttctctttttc gtctttgctattattctagcttatatgtctacaaaataa

DBGET integrated database retrieval system