KEGG   Limnohabitans sp. 63ED37-2: L63ED372_00507Help
Entry
L63ED372_00507    CDS       T04121                                 

Gene name
cbbS1
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain 1
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
lih  Limnohabitans sp. 63ED37-2
Pathway
lih00630  Glyoxylate and dicarboxylate metabolism
lih01100  Metabolic pathways
lih01120  Microbial metabolism in diverse environments
lih01200  Carbon metabolism
Module
lih_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lih_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
lih_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:lih00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    L63ED372_00507 (cbbS1)
Enzymes [BR:lih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     L63ED372_00507 (cbbS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Ribosomal_S13_N
Motif
Other DBs
NCBI-ProteinID: ALK87734
UniProt: A0A0P0M7A1
LinkDB All DBs
Position
535240..535593
Genome map
AA seq 117 aa AA seqDB search
MSMQDYNSRLSDPASRKFETFSYLPAMTKEEIRKQVEYLVKKGLNPAIEHTEPQYLMDSY
WYMWKLPMFGETDVDKVLAECEACRQANPDNHIRLIGYNNFTQSQGASMVIFRGKTV
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgcaagactacaactcccgcttgtccgatccggccagccgcaagttcgagacc
ttctcttacttgcccgcgatgaccaaggaagagattcgcaaacaagtggaatacctggtc
aaaaaaggcctgaaccccgccatcgaacacaccgaaccccagtacctgatggactcttac
tggtacatgtggaagctgcccatgttcggtgaaaccgatgtggacaaggtgctggccgaa
tgcgaagcctgccgccaagccaacccggacaaccacatccgtttgatcggctacaacaac
ttcacgcagtcgcaaggcgcgtcgatggtgatcttccgcggtaaaaccgtttaa

DBGET integrated database retrieval system