KEGG   Limnohabitans sp. 103DPR2: L103DPR2_02148Help
Entry
L103DPR2_02148    CDS       T04120                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lim  Limnohabitans sp. 103DPR2
Brite
KEGG Orthology (KO) [BR:lim00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L103DPR2_02148 (ahpF)
Enzymes [BR:lim01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     L103DPR2_02148 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_binding_2 Glutaredoxin FAD_oxidored DAO NAD_binding_7 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 Thi4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ALK92538
UniProt: A0A0P0MH09
LinkDB All DBs
Position
complement(2223948..2225513)
Genome map
AA seq 521 aa AA seqDB search
MLDDTLKSQLQTYLGMLRNPIRLVATLDDSETGVEMRSLLETIVSLSDKVSLDTSGSDAR
KPSFVVAREGETQGVRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVLDAIKALDGDFNF
EVYMSMSCHNCPDVVQALSLMAIFNPKVKTVVIEGGAFQQEVTEREIMAVPMVFLNGKVF
GSGRMSVEEIVAKLDTGAADREAAKLSAKKAFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQVNDTMAIENYISVLETDGPKFGAALEQQVRHYGVDIMNLQKAAKVVPATEPGG
LIQVQMENGGALSARTVILSTGARWRNVNVPGEQEYKNKGVAYCPHCDGPLFKGKRTAVI
GGGNSGIEAAIDLAGIVAHVTVIEFADQLKADAVLVNKLKSLNNVTIHTNAQTTEITGDG
SVVNGIRFKDRVSGEEHHVALEGVFVQIGLIPNTEFLKDTFELSKFGEIVVDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGEGAKAALSAFDHLIRTPVAA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagacgacacactcaaatcgcaattgcaaacctacttgggcatgttgcgaaacccc
atccgattggtcgctactttggacgacagcgaaacaggtgtggaaatgcgcagcctgctc
gaaaccattgtgagtttgtcagacaaagtgtcattggacacctccggcagtgacgctcgt
aaaccatcctttgtggtggcgcgtgaaggcgaaacacagggtgtgcgttttgctggcttg
ccattgggtcacgagttcacctctttggtcttggctttgctctggacgggtggccatcca
cccaaggttgagcaagacgtgctcgatgccatcaaagccttggatggcgacttcaatttt
gaggtctacatgtctatgtcttgccacaactgcccagacgtggtgcaggctttgtcgctg
atggccatcttcaaccctaaggtcaagaccgttgtgattgaaggcggtgcttttcagcaa
gaagtcaccgaacgcgaaatcatggccgttcccatggtgttcttgaacggcaaagtcttt
ggttcaggtcgcatgagtgtggaagagatcgtggccaaattggacacgggcgcagcagac
cgtgaagccgccaaactgagtgccaaaaaagcctttgatgtgttgattgtgggcggcggt
cctgcaggcgctgctgctgcagtttatgctgcacgcaaaggcattcgcgtgggtgtggcg
gcagagcgatttggcggtcaagtgaacgacaccatggccattgaaaactacatctctgtt
ttggagacagacggtcccaaatttggcgcggccttagagcaacaagttcgccactacggt
gtcgatatcatgaatttacagaaggcagccaaagtggtacccgccacagagcctggcggc
ctgattcaagtacaaatggaaaatggcggcgcattgagtgcacgcaccgtgattctttca
accggcgctcgctggcgcaatgtcaatgtacctggcgagcaagagtacaaaaacaaaggc
gtggcgtactgcccacattgcgatggtcctttgttcaagggcaagcgtactgcggtcatt
ggcggtggtaactctggcattgaagcggccattgatttggctggtatcgtggcccacgtc
accgtcattgagtttgccgatcaactcaaggccgatgcggtgctggtgaacaagctcaag
agcttgaataacgtcaccattcacaccaacgcgcaaaccaccgaaattaccggcgacggc
agtgttgtcaatggcattcgtttcaaagatcgtgtgtctggagaagaacaccacgtggcc
ttagaaggtgtgttcgttcaaattggtttgatccccaacaccgagtttttaaaggacact
tttgagctaagcaaattcggtgagattgtggtggatgccaagggtcataccaacgtgcca
ggcgtgtttgccgcgggcgattgcaccaccgtgccgtacaaacaaattgtgattgcggcc
ggtgagggtgccaaagcagccctcagtgcgtttgatcacctgattcggacccctgtggcg
gcttga

DBGET integrated database retrieval system