KEGG   Lactobacillus johnsonii N6.2: T285_03420Help
Entry
T285_03420        CDS       T02941                                 

Definition
(GenBank) multidrug MFS transporter
Organism
ljn  Lactobacillus johnsonii N6.2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_2 DUF2975
Motif
Other DBs
NCBI-ProteinID: AHA97108
UniProt: V5P294
LinkDB All DBs
Position
complement(701300..702772)
Genome map
AA seq 490 aa AA seqDB search
MDKQPTDIHGKSYNRNLLVLVLIIGSFCTVLNGTLLATALPSIMRSFHISTATAEWLSTA
FLLVNGVMIPISAWLINRFGSRKMYLSAMSVFFIGTVIAAIAPNFGTLLAGRIIQGLGVG
VTMPLLQTIMLSIFPANKRGAAMGTVGIVIGLAPAIGPTLSGWIVDNLSWRYLFSIIAPI
AGVVIILAFFLIKDVLPTKKEKIDILSVTTSTVGFGSLLYGFSEAGNKGWTNPEILMFIG
VGIVFVIIFGLRQLKMSDPFLDITVFKHFEFSLAAALSGITNLAMVGIEMVLPLYIQNLR
GVSAFHSGLMLLPGALMIGIMSPITGRLFDKYGARKMAITGMTLLTLGTIPFVFLTEQSS
YTMIIVLYAIRMVGVALVMMNVTTSGMNSLPLDKISHGTAVNNTFRQVLSSIGTAILVSV
LTTATNNNMPSKELLKTLPLQYKNQAINATLDGFHASFAMSIVFALIALVLAFFLKKGNR
ARENQEEVNG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaacccaccgatattcatggaaagtcctataatcgaaacttactggtatta
gttttaattattggttctttctgtactgtgttaaacgggacattgcttgctactgctcta
ccttcaataatgcgttcctttcatatcagcactgcaactgctgaatggctttcaacagca
tttttgctagttaacggagtaatgatcccaatttccgcatggctaatcaatcgctttgga
tcaagaaaaatgtacttgagtgcaatgtctgttttctttattggaacagttatcgcagca
attgcaccgaactttggcaccctacttgctggtagaattattcaaggattaggtgttgga
gtcacgatgcctcttcttcaaaccattatgctttctatctttccagctaataaacgtggg
gctgctatgggaactgttggtattgttatcggcttagctcctgccatcggcccaacttta
tctggatggatcgttgataatctttcttggcgctacttatttagtattattgccccaatt
gctggcgtggttattatattagctttctttttaattaaagatgtactccctactaaaaaa
gaaaaaattgatattttatctgtaaccacttctactgttggatttgggagcttactttat
ggtttctccgaggccggcaacaaaggttggactaatccagaaattttaatgtttattggt
gtagggatagtatttgtcatcatcttcggtcttcgtcaattgaaaatgtcagatcctttc
ttagatattactgtgttcaaacactttgaattttctttagctgcagcccttagtggtatt
acaaatttggccatggttggtatcgagatggtgctacctttatatattcaaaacttacgg
ggagtatctgcatttcattcaggtttaatgcttttgccaggtgctctaatgattggaatt
atgtcaccaattacgggacgtttattcgataaatatggtgcccgcaagatggccattacg
ggaatgacccttttaacattaggtacaatcccatttgtatttttgactgagcagagttcc
tataccatgattatcgttttatacgcaatcagaatggtcggagtagccttagttatgatg
aatgttactacttctgggatgaactcattgcctttagacaagatttcacacggaactgca
gtaaacaatacatttagacaagttttaagttcaattggtactgccattttagtctctgtc
ttaactactgcgactaacaacaacatgccaagtaaagaattactgaaaactttaccactt
caatataaaaatcaagctattaatgctactttagatggattccatgcttcctttgccatg
agcattgtctttgcattaattgctttggttcttgccttcttcctcaagaaaggtaaccgt
gcccgtgaaaatcaagaagaggtgaatggataa

DBGET integrated database retrieval system