KEGG   Lactobacillus johnsonii NCC 533: LJ_0492
Entry
LJ_0492           CDS       T00158                                 

Definition
(GenBank) hypothetical protein
  KO
K03693  penicillin-binding protein 1B
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
ljo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0492
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LJ_0492
Glycosyltransferases [BR:ljo01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   LJ_0492
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   LJ_0492
SSDB
Motif
Pfam: Transgly Transpeptidase DUF2120
Other DBs
NCBI-ProteinID: AAS08484
UniProt: Q74KT5
LinkDB
Position
complement(546491..549307)
AA seq 938 aa
MKNLKEKIRKFLTAGPEVKTLQSESDESQWKFYSGIVYLTLRRVFHYFILIAFFGLFLLI
GFGGGYALGIVRNQPIPTISELNHQINHAQNSATLYYAGNKKIATVRPDTVTKKASESEL
TPLVKNAVTATEDENFYIHKGVLPKSLVRAVLSELTGVGVQTGGSTLTQQLVKMQFLTSQ
TTWRRKVTEMFYAHKIEKHFSKEDILRAYLNAAPYGKNNRGENIVGIKTAAEGIFGKSIS
ELNLPQAAFIAGLPQSPSVYTPYRLNGKVKSDLDLAMRRKDIVLFRMYRNGDISKKAYLA
AKKYDLRADFLAPEKAPKQKKQSGYLYNLVMNKSASLLAENLIEQDGLKVSDVKQDINRY
NQYLTSATELLHQKGYHIKTTIRKPLYQTMQQVVKQNKYGQDRTSRDFDSSTNKWVNTTE
HVENGSVVIDNATGKVLAFSGGVDFKNSQINHAFDTYRSPGSSIKPYLVYGPAIEHKLIS
SQTAIADFPTRFGNYIPTDYNSTVENRFISAQEALSKSYNLPAVNLYSKLVNDKNINLRQ
DMKKLGLNLSKSEFENLGLALGGTDYGFSVADNASAFSNFYNNGKRADPYYIEEIQDPSG
RVIYKHKQDSQKVFSTGTSYIMQKMLHQVVTKGTASSLTGTLKFDYKNLIGKTGTSNDYR
DIWFNGSTPGITISSWMGYDNFYGHSYNLDSNSSETNLNLWVNIANALYKEDPSIFKLND
APTRPRSVYKNRVLARTGTLPGTVSYDGDNIDLSGKKTTALSLSPAPNATARFGIGGSTK
DYNLFYDYLEGKNNDYGKVLIYTGKTISKKKNINGLFSVADGSTSENAKNYYGKNHEVYR
ESNNNSSSSTNRNVGANDEQARSTGQGGNNNSSSTTRSTTSTREASSSQNNRSESSNANE
ANEVNSNISPSESAPISGSASTEATAGDAAADNAPTAP
NT seq 2817 nt   +upstreamnt  +downstreamnt
gtgaaaaatttaaaagagaaaatcagaaagttcctaactgcggggccagaagttaaaaca
ctgcaaagcgaatcagatgaaagccagtggaaattttacagtggtatcgtctatttaact
ttgcgccgtgtttttcattattttatcttaattgcatttttcggtttatttttactaatt
ggttttggcggcggttatgcacttggtattgttcgtaatcaacctattccaactattagc
gaattaaatcatcaaataaatcatgctcaaaattcagctacactctactatgctggtaat
aaaaaaattgctactgttcgaccagatacagttactaaaaaggcgagtgaaagtgaatta
actcccctcgttaagaatgctgtaacagccactgaggatgaaaacttttatattcataag
ggtgttttacctaagtccttagttagagctgtcctttctgaattaacaggtgttggtgtg
cagaccggtgggtcaactttaactcagcagttggttaagatgcaattcttaactagccaa
acaacctggagaagaaaagttactgaaatgttttatgctcataagatcgaaaaacatttt
tctaaagaagacattctccgtgcatatttaaatgctgccccttatggtaaaaataatcgc
ggagaaaatattgtcggcattaaaactgctgctgaaggtatatttggtaaatcaatttct
gaacttaatttaccgcaagctgcttttattgctggtctgcctcaaagtccgtctgtatat
actccatatcgcttaaatggaaaagttaaaagtgatcttgacttagcaatgcggagaaaa
gacattgttttattccgtatgtacagaaatggcgacattagtaaaaaagcttatcttgca
gctaaaaaatatgatttgcgcgctgacttccttgctcctgaaaaagcaccgaagcaaaag
aaacaaagcggttatttatacaatctagtaatgaataagagtgccagtcttttagccgaa
aacttgattgaacaagatggtttaaaagtatctgacgttaaacaagatataaaccgctat
aatcagtacctaactagcgcaactgagcttcttcatcaaaaaggctatcacatcaaaact
acaattagaaagccactataccagaccatgcaacaagttgttaagcaaaacaagtatggt
caagaccgaacttctcgcgattttgattcttctactaacaagtgggttaataccaccgaa
cacgtggaaaacggtagtgtcgtaattgataatgctaccggtaaggtcttagcatttagc
ggtggggttgactttaaaaattctcaaattaaccatgcctttgatacttaccgctctcct
ggttcttcaattaagccatatttagtttatggcccagctatagagcataagcttatttca
agccaaactgcaattgctgacttccctaccagatttggtaactatattccaactgactat
aactcaactgttgaaaacagatttatttcagctcaggaagctttaagtaagtcttataac
cttcctgctgtaaatttatacagtaagttagttaacgataaaaatatcaatctgcgtcaa
gatatgaagaaattaggcttaaatttaagtaagagcgaatttgaaaacttaggattagct
cttggtggtactgattacggtttttcagtagccgataatgctagtgctttttctaacttc
tataacaatggtaaacgtgcggatccatattatattgaagaaattcaagatccatccggt
cgagtaatctataaacacaaacaagattcacagaaagtcttctctacaggcacttcctac
attatgcagaagatgctacaccaagtagtaactaaagggacagcttcgagcttaaccggt
accttgaagttcgactacaagaatctaattggtaaaactggaaccagtaatgattatcgt
gatatttggtttaatggatctactcctggaattacaatttctagttggatgggctatgat
aacttctatggtcattcatacaacttagattctaattctagtgagactaatttaaattta
tgggtcaatattgctaatgcattatataaggaagatccatcgatctttaaattaaatgat
gctcctacgcgtccacgctccgtttataaaaatagagtcttagcaagaacaggaacatta
cctggaacggtaagctatgatggcgataatattgatctcagtggcaaaaagactaccgca
ttaagtctttcaccagcaccaaatgcaactgctagatttggtattggtggctcaactaaa
gactacaacctcttctatgattacttagaaggtaaaaataatgactatggtaaagtctta
atctacactggtaagacgatttctaagaagaagaatattaatggtctcttctctgtagct
gatggatcaacttcagaaaatgcaaaaaattattatggtaaaaaccatgaagtttatcgt
gaatctaataataattcttcttcctcaactaatcggaatgtaggagctaatgatgaacaa
gctaggagtacaggacaaggaggaaacaataattcttcctcaactacgagaagtaccact
tctactcgtgaggcttcttcatctcaaaataacagatcagaaagtagtaacgctaatgaa
gctaatgaagtaaattcaaatattagtccaagtgaaagtgctcctattagcggatctgct
agcacagaagctactgcaggtgatgcggcagcagataatgctcctactgctccataa

DBGET integrated database retrieval system