KEGG   Lactobacillus johnsonii NCC 533: LJ_0685
Entry
LJ_0685           CDS       T00158                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00550  Peptidoglycan biosynthesis
ljo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LJ_0685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ljo01002]
    LJ_0685
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
    LJ_0685
Enzymes [BR:ljo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LJ_0685
Peptidases and inhibitors [BR:ljo01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   LJ_0685
Peptidoglycan biosynthesis and degradation proteins [BR:ljo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   LJ_0685
SSDB
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Glutaminase Peptidase_S13
Other DBs
NCBI-ProteinID: AAS08503
UniProt: Q74KR6
LinkDB
Position
574927..575853
AA seq 308 aa
MRHAKKKSRKKYLWLISLVIAAICFFVWKNNFNSNRMPANYHADQVDLNVKAAVAINAKD
GSTIYAKNANQSLPIASMTKLLTVYLTLQAIKEKKISWDTTVTPTQEIVDLGSNPDYASV
PLRLGQKYTVRELYDAALIKSANNAARLLAIAVSGSETNFLNQMRQQARKWKLNNAKFVT
VDGLPEKKKNFLGMTTTVENKMSANDMAIVARKLITNYPEILNTTKLARAYFQNTLMTNS
NKMLNGLSYYDSTFPVDGLKTGTTDGAGSCFTCTVNKNGKRVITVILGAENDNERFVETK
KLLSYCFN
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagacatgcaaagaagaaatctaggaaaaagtatttatggttaattagccttgtaata
gcagctatttgtttttttgtatggaaaaacaattttaactcaaatagaatgccagctaat
tatcatgctgaccaagtagatttaaacgttaaagctgccgtagcaattaatgcaaaagat
ggatcaaccatttacgctaaaaatgctaatcaaagcttgccgattgcctcaatgaccaag
cttttaaccgtttacttaactctccaagcaattaaagagaaaaagatatcttgggacaca
acggttactccgactcaagaaatagttgacttgggctcaaatccagattacgcaagtgtt
ccacttaggctaggacaaaaatataccgtcagagaactatacgatgcggctttaataaag
tcggcaaataatgcagctcgtttactcgcgattgcagttagtggaagcgagacaaatttt
ctaaatcaaatgcgccagcaagctcgtaaatggaaactcaataatgctaaattcgtaact
gttgatggtttaccagagaaaaagaaaaattttttagggatgacgacaacagttgaaaat
aaaatgagtgccaatgatatggcgattgtagcaagaaaattaataactaattatcctgaa
attctaaatactacgaaactagctagagcatattttcaaaatactcttatgactaatagt
aataaaatgttaaacggtctctcatactatgattcgacatttcctgttgatggtttaaag
acaggtactactgatggcgctggttcatgttttacttgtacagtgaataaaaatggaaaa
agagtgattacagtaattttaggtgctgaaaatgataatgaacggtttgtggagacaaaa
aagttattaagttactgttttaattaa

DBGET integrated database retrieval system